AVSS

University of California

Automated Vital Statistics System

Quick Reference Manual

 

 

 

 

 

 

 

 

 

 

AVSS PROJECT

UNIVERSITY OF CALIFORNIA

INSTITUTE FOR SOCIAL, BEHAVIORAL,

AND ECONOMIC RESEARCH

SANTA BARBARA, CA93106

 

January 2007

 

 

 

 

 

 

 

 


 

 

 

 

 

 

 

 

 

ACKNOWLEDGEMENTS

 

 

This manual was updated in 2006 by Glen Nishida as originally written by Ellen Needham and Sharon Sasaki.

 

 

This document may be copied and distributed without restriction.

 

 

Please address all questions regarding AVSS to:

 

AVSS Project

Institute for Social, Behavioral, and Economic Research

University of California

Santa Barbara, CA93106-2150

805-893-3214

 

 

 

TRADEMARKS

 

Automated Vital Statistics System and AVSS are trademarks of the

Regents of the University of California

 

 


TABLE OF CONTENTS

 

 

HOSPITAL BIRTH RECORD............................................................................................................................................................ 5

REGISTER BIRTH RECORD............................................................................................................................................. 5

DISPLAY RECORD........................................................................................................................................................... 10

EDIT RECORD................................................................................................................................................................... 13

ALPHA LIST OF RECORDS............................................................................................................................................. 15

COMPLETE INCOMPLETE RECORD........................................................................................................................... 16

INCOMPLETE RECORD.............................................................................................................................................. 16

SKIPPED FIELD(S)....................................................................................................................................................... 16

INCOMPLETE RECORD REPORT................................................................................................................................ 17

FILING VARIABLE LIST..................................................................................................................................................... 18

VARIABLE DISPLAY.......................................................................................................................................................... 19

INDEX LIST DISPLAY........................................................................................................................................................ 21

NON-CONFIDENTIAL DISPLAY...................................................................................................................................... 22

VALIDATION DISPLAY...................................................................................................................................................... 23

INDIVIDUAL INQUIRY....................................................................................................................................................... 24

USER REPORT................................................................................................................................................................. 25

USER REPORT BY ACTIVITY INDEX............................................................................................................................. 26

USER SUMMARY............................................................................................................................................................... 27

PRINT RECORD................................................................................................................................................................ 28

SCRATCH RECORD........................................................................................................................................................ 29

MODIFY USER LISTS....................................................................................................................................................... 30

ADDING A NEW CERTIFIER/ATTENDANT NAME................................................................................................... 30

EDITING A CERTIFIERíS/ATTENDANT'S INFORMATION...................................................................................... 31

LIST CERTIFIERS/ATTENDANTS.............................................................................................................................. 32

DELETING A CERTIFIER/ATTENDANT..................................................................................................................... 33

ATTENDANT LIST.............................................................................................................................................................. 34

ADDING A NEW ATTENDANT..................................................................................................................................... 34

LIST ATTENDANTS....................................................................................................................................................... 34

EDIT AN ATTENDANT................................................................................................................................................... 35

DELETING AN ATTENDANT........................................................................................................................................ 35

PROCESS REGISTRAR REFUSED RECORDS......................................................................................................... 36

VERIFICATION LETTER................................................................................................................................................... 37

DUPLICATE RECORD REPORT BASED ON NAME.................................................................................................. 39

LIST TO BE SENT TO HEALTH DEPT........................................................................................................................... 40

SELECTING RECORDS FOR LIST............................................................................................................................ 40

DISPLAYING RECORDS ON LIST............................................................................................................................. 40

REMOVING RECORDS FROM LIST.......................................................................................................................... 41

PRINTING RECORDS ON LIST.................................................................................................................................. 41

GENERATE HOSPITAL CBC FILE................................................................................................................................. 42

HOSPITAL UNSENT LIST OF INCOMPLETES............................................................................................................ 43

NEWSPAPER ANNOUNCEMENT REPORT................................................................................................................ 44

HP LASERJET FORM ALIGNMENT................................................................................................................................ 45


TABLE OF CONTENTS (continued)

 

 

MAILBOX......................................................................................................................................................................................... 46

SEND MAIL......................................................................................................................................................................... 47

PRINT MAIL......................................................................................................................................................................... 48

MESSAGES, MANAGER'S............................................................................................................................................ 47

MESSAGES, USER'S.................................................................................................................................................... 47

DELETE MAIL..................................................................................................................................................................... 49

MESSAGES, MANAGER'S............................................................................................................................................ 49

MESSAGES, USER'S.................................................................................................................................................... 50

REPORT STATUS OF SENT MAIL.................................................................................................................................. 51

YOUR PASSWORD........................................................................................................................................................................ 52

CHANGE YOUR PASSWORD......................................................................................................................................... 52

REPORT GENERATOR.................................................................................................................................................................. 53

QUERY DATABASE........................................................................................................................................................... 53

GENERATE REPORT - RUNNING A REPORT IN THE FOREGROUND................................................................ 58

GENERATE REPORT - RUNNING A REPORT IN THE BACKGROUND................................................................ 59

OUTPUT SAVED REPORT.............................................................................................................................................. 60

LIST SAVED REPORTS.................................................................................................................................................... 63

DELETE SAVED REPORT............................................................................................................................................... 64

SYSTEM MAINTENANCE.............................................................................................................................................................. 65

ID FILE................................................................................................................................................................................. 65

ADD A USER.................................................................................................................................................................. 65

EDIT A USER.................................................................................................................................................................. 66

DEACTIVATE A USER................................................................................................................................................... 67

REACTIVATE A USER................................................................................................................................................... 67

LIST USERS................................................................................................................................................................... 68

LIST USERS' LAST LOGIN.......................................................................................................................................... 68

CLASSIFICATION/SECURITY OPTION TABLES........................................................................................................................ 69

GLOSSARY OF TERMS................................................................................................................................................................. 71

ERRORS/WARNINGS.................................................................................................................................................................... 73

CROSS-REFERENCES, VALIDATIONS, AND WARNINGS....................................................................................................... 74

VS-10A MEDICAL DATA SUPPLEMENTAL WORKSHEET..................................................................................................... 76

VS-10B RACE IDENTIFICATION WORKSHEET......................................................................................................................... 78

INDEX............................................................................................................................................................................................... 79

GENERAL COMMANDS................................................................................................................................................................. 81

BIRTH REGISTRATION COMMANDS.......................................................................................................................................... 81

EDIT COMMANDS.................................................................................................................................................................. 81

 


 

AVSS Quick Reference Manual†††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††† Hospital Birth Record, Register Birth Record

 

 

REGISTER BIRTH RECORD

 

The process in AVSS of entering and storing data needed to complete a certificate of live birth.Data entry is accomplished using a simple item-by-item prompting sequence.All information is entered in the same order that it will be later be displayed on a CERTIFICATE OF LIVE BIRTH.After entering the data, you will be allowed to print and then file the data as a permanent record in AVSS.If you do not know what to enter or how to spell the word press F1 (or Type Ď?í) for help or F3 (Ď^Lí) for a list.You can also type the first one to three letters then enter to get a shorter list.

 

Note:†† If you are entering a birth that occurred outside of your hospital, be sure you signed onto AVSS using the HOME password.

SYSTEM OPTION > [H] [Enter] OSPITAL BIRTH RECORD

HOSPITAL BIRTH RECORD OPTION > [R] [Enter] EGISTER BIRTH RECORD

BPF. BABY'S PATIENT FILE NUMBER > [696] [Enter]

1A. FIRST (GIVEN) NAME OF CHILD > [JOHN] [Enter]

1B. MIDDLE NAME OF CHILD > [PAUL] [Enter]

1C. LAST (FAMILY) NAME OF CHILD (SURNAME) > [JONES] [Enter]

CHECKING FOR POSSIBLE DUPLICATES USING: JON, JO

(USE CTRL-C TO TERMINATE SEARCH)

2. SEX OF CHILD > [M] [Enter] ALE

3A. THIS BIRTH SINGLE, TWIN, ETC. <SINGLE> [Enter]

4A. DATE OF BIRTH > [010107] [Enter]††† CONVERTED TO 01/01/2007

CHECKING FOR POSSIBLE DUPLICATES USING: JON, JO 1/1/2007

(USE CTRL-C TO TERMINATE SEARCH)

4B. HOUR OF BIRTH (24 HOUR CLOCK) > [10:53 P] [Enter]†††† CONVERTED TO: 2253

MAR. MOTHER MARRIED (AT ANY TIME DURING THE PREGNANCY) > [NO] [Enter]

Note:†† If you enter Y, you will go to field 6A-FIRST (GIVEN) NAME OF FATHER.

††††††††††††

ACCORDING TO STATE LAW, IN ORDER FOR THE FATHER'S NAME TO BE PRINTED IN FIELDS

6A-6C, THE PARENTS MUST BE MARRIED TO EACH OTHER OR THE MOTHER AND THE FATHER

MUST SIGN A VOLUNTARY DECLARATION OF PATERNITY AT THE HOSPITAL BEFORE THE

BIRTH CERTIFICATE IS PREPARED.

DECP.†††††† DO YOU HAVE A DECLARATION OF PATERNITY SIGNED BY THE FATHER & MOTHER

> [Y][Enter]ES

Note:†† If you enter N, you will go to field 7-FATHERíS STATE OF BIRTH.

Fatherís name will contain dashes and you will not be able to enter or edit that data.

6A. FIRST (GIVEN) NAME OF FATHER > [ROBERT] [Enter]

6B. MIDDLE NAME OF FATHER > [DAVID] [Enter]

6C. LAST (FAMILY) NAME OF FATHER (SURNAME) > [JONES] [Enter]

7. FATHER'S STATE OF BIRTH > [AK] [Enter] = ALASKA(AK)

8. FATHER'S DATE OF BIRTH > [050539] [Enter]


AVSS Quick Reference Manual†††††††††††††††††††††††††††††††††††††††††††††††††† Hospital Birth Record, Register Birth Record (continued)

 

05/05/1939 <-- ASSUMED DATE

FATHER'S AGE AT CHILD'S BIRTH COMPUTED: 67

CONVERTED TO 05/05/1939

 

FATHER'S AGE (COMPUTED FROM FIELD 8) IS OUTSIDE

THE RANGE 15 THRU 64, INCLUSIVE.

 

VALIDATION: FAGE

THE STATE REGISTRAR REQUIRES THAT THE FOLLOWING

COMBINATION OF FIELD(S)/VALUE(S) BE VALIDATED:

FIELD: 8 = '05/05/1939'

FIELD: FAGE = '67'

 

YOU WILL LATER BE ASKED TO VALIDATE THIS VALUE,

IF YOU ARE UNSURE OF ITS VALIDITY, BACKUP WITH AN '^' AND USE '^S' TO SKIP.

 

Note:†† The following line illustrates the CONCATENATE command.

9A. FIRST (GIVEN) NAME OF MOTHER > [MARIA;ELENA;SANCHEZ] [Enter]

9B. MIDDLE NAME OF MOTHER > ELENA

9C. BIRTH LAST (FAMILY) NAME OF MOTHER (MAIDEN SURNAME) > SANCHEZ

MLN. MOTHER'S CURRENT LAST NAME > [JONES] [Enter]

10. MOTHER'S STATE OF BIRTH > [MX] [Enter] = MEXICO (MEXICO)

 

11. MOTHER'S DATE OF BIRTH > [060680] [Enter]

06/06/1980 <-- ASSUMED DATE

MOTHER'S AGE AT CHILD'S BIRTH COMPUTED: 26

CONVERTED TO 06/06/1980

12A. PARENT OR OTHER INFORMANT - SIGNATURE (SURNAME ONLY)

††††††††††††††††††††††††††††††††††††† > [JONES] [Enter]

12B. INFORMANT'S RELATIONSHIP TO CHILD > [MO] [Enter]THER

12C. DATE INFORMANT SIGNED > [010107] [Enter]

CONVERTED TO 01/01/2007

13D. NAME, TITLE AND MAILING ADDRESS OF ATTENDANT

†††††††††††††††† > [BO] [Enter] WLES,NAN,CNM,1200 N STATE ST, LA††††† (434)

 

TYPE.ATTENDANT CODE <C.N.M.> [Enter] C.N.M. (CERTIFIED NURSE MIDWIFE OR CNM) (3) (ITYPE=3)

13C. DATE ATTENDANT OR CERTIFIER SIGNED > [Type ^S or Press F3 Key] [Enter]

14. NAME AND TITLE OF CERTIFIER IF NOT ATTENDANT > [Enter]

15A.†††† DATE OF DEATH > [Enter]

 

Note:Starting Jan. 1, 2000, up to three multiple races are allowed per person for the fatherís and motherís race (Fields 18 and 21).Withheld and unknown are allowed for Fatherís and Motherís race #1 only.If you do not know how to spell the race enter the first one to three letters and choose from a list.You must choose from the AVSS List.If it is absolutely necessary to enter a race not contained on the AVSS List, please contact your local registrar of births.

19. FATHER HISPANIC > [NO] [Enter]

 

18A. FATHER'S RACE #1 > [IRI] [Enter] SH


AVSS Quick Reference Manual††††††††††††††††††††††††††††††††††††††††††††††††† Hospital Birth Record, Register Birth Record (continued)

 

18B. FATHER'S RACE #2 > [JA] [Enter]

1†††††††††† JACK WHITE

2†††††††††† JACKSON WITE

3†††††††††† JAMAICAN

4†††††††† ††JAPANESE

5†††††††††† JAVA

 

SELECTION # > [4] [Enter] JAPANESE

 

18C. FATHER'S RACE #3 > [CHUM] [Enter] ASH

 

20. FATHER - DATE LAST WORKED (MONTH/YEAR) > [12/06] [Enter]

 

20A. FATHER'S USUAL OCCUPATION > [PROGRAMMER] [Enter]

 

20B. FATHER'S USUAL KIND OF BUSINESS OR INDUSTRY

†††††††††††††††††††††††††††††††††††††††† > [BANKING] [Enter]

 

20C. HIGHEST DEGREE OR LEVEL OF SCHOOL COMPLETED BY THE FATHER

†††††††††††††††††††††††††††††††††††††††††††††††††††††††††††† > [12] = 12TH GRADE,

BUT NO DIPLOMA

 

DO NOT ENTER 12 IF THE FATHER EARNED A HIGH SCHOOL DIPLOMA, GED OR HIGHER

DEGREE. 12 SHOULD ONLY BE ENTERED IF THE FATHER COMPLETED THE 12TH GRADE BUT

DID NOT EARN A DIPLOMA. ARE YOU SURE? <N> [Y] [Enter]

 

22. MOTHER HISPANIC > [MEXI] [Enter] CAN

 

21A. MOTHER'S RACE #1 > [HISP] [Enter]

1†††††††††† HISPANIC

2†††††††††† HISPANO

 

SELECTION # > [1] [Enter] HISPANIC

 

21B. MOTHER'S RACE #2 > [SAM] [Enter] OAN

 

21C. MOTHER'S RACE #3 > [Enter]

 

23. MOTHER - DATE LAST WORKED (MONTH/YEAR) > [11/06] [Enter]

 

23A. MOTHER'S USUAL OCCUPATION > [VICE-PRESIDENT] [Enter]

 

23B. MOTHER'S USUAL KIND OF BUSINESS OR INDUSTRY

†††††††††††††††††††††††††††††††††††††††† > [BANKING] [Enter]

 

23C. HIGHEST DEGREE OR LEVEL OF SCHOOL COMPLETED BY THE MOTHER

††††††††††††††††††††††††† †††††††††††††††††††††††††††††††††††> [BACH] ELOR'S DEGREE

(E.G. BA, AB, BS)

 

24A. MOTHER'S RESIDENCE (STREET, NUMBER OR LOCATION)

†††††††††††††††††† > [4321 MAPLE STREET] [Enter]

 

24E. MOTHER'S RESIDENCE ZIP CODE > [90011] [Enter] = LOS ANGELES

 

24D. MOTHER'S STATE OF RESIDENCE <CA> [Enter] = CALIFORNIA (CA)

 

24B. MOTHER'S COUNTY OF RESIDENCE <LOS ANGELES> [Enter]

 

24C. MOTHER'S RESIDENCE CITY OR TOWN <LOS ANGELES>

†††††††††††††††††††††††† > [Enter]

 

DO NOT ANSWER 'YES' TO THE NEXT PROMPT UNLESS YOU HAVE RECEIVED INSTRUCTIONS ON

USING THE ENUMERATION AT BIRTH CONSENT FORM.


AVSS Quick Reference Manual†††††††††††††††††††††††††††††††††††††††††††††††††† Hospital Birth Record, Register Birth Record (continued)

 

SSA1. ISSUE SOCIAL SECURITY NUMBER? <NO> [Y] [Enter] ES

 

SSA2. SHARE SSA NUMBER WITH HEALTH DEPARTMENT? <NO> [Y] [Enter] ES

 

MSTREET. MAILING ADDRESS (STREET NUMBER & NAME OR P.O. BOX) > [PO BOX 1065] [Enter]

 

MZIP. MAILING ADDRESS ZIP CODE > [90011] [Enter] = LOS ANGELES

 

MSTATE. MAILING ADDRESS STATE > [CA] [Enter] = CALIFORNIA†† (CA)

 

MCOUNTY. MAILING ADDRESS COUNTY > [19] [Enter] = LOS ANGELES

 

MCITY. MAILING ADDRESS CITY OR TOWN > [LOS] [Enter]

1†††††††††† LOS ANGELES

2†††††††††† LOS FELIZ

3†††††††††† LOS NIETOS

 

SELECTION # > [1] [Enter]†† LOS ANGELES

(Hit ENTER If motherís residence is the same as mailing address)

 

WIC. DID MOTHER GET WIC FOOD FOR HERSELF DURING THIS PREGNANCY > [N] [Enter]O

 

CIGPN. AVERAGE NUMBER OF CIGARETTES/PACKS PER DAY FOR THREE MONTHS PRIOR TO††††

PREGNANCY > [0] [Enter]

 

CIGFN. AVERAGE NUMBER OF CIGARETTES/PACKS PER DAY FIRST THREE MONTHS OF††††††††

PREGNANCY > [0] [Enter]

 

CIGSN. AVERAGE NUMBER OF CIGARETTES/PACKS PER DAY SECOND THREE MONTHS OF†††††††

PREGNANCY > [0] [Enter]

 

CIGTN. AVERAGE NUMBER OF CIGARETTES/PACKS PER DAY THIRD TRIMESTER > [0] [Enter]

 

MWT1. MOTHER'S PREPREGNANCY WEIGHT IN POUNDS > [140] [Enter]

 

MWT2. MOTHER'S DELIVERY WEIGHT IN POUNDS > [160] [Enter]

 

MHT. MOTHER'S HEIGHT IN FEET/INCHES > [5/7] [Enter] (CONVERTED TO 5'7'')

 

APGAR1. APGAR SCORE AT 1 MINUTE > [8] [Enter] = 08

 

APGAR5. APGAR SCORE AT 5 MINUTES > [9] [Enter] = 09

 

APGAR10. APGAR SCORE AT 10 MINUTES > [UNK] [Enter] = UNKNOWN OR NOT TAKEN

 

25A. DATE LAST NORMAL MENSES BEGAN > [4 06] [Enter]

THE VALUE YOU ENTERED: '4 06' CAN BE INTERPRETED IN TWO WAYS:

1. 04/--/2006

2. 04/06/2006

PLEASE CHOOSE 1 OR 2 > [1] [Enter]

CONVERTED TO 04/--/2006

 

ESTIMATED GESTATIONAL AGE (COMPUTED): 37.2E WEEKS.

 

25AA. DATE FIRST PRENATAL CARE VISIT > [090306] [Enter]

09/03/2006 <-- ASSUMED DATE

 

25B. MONTH OF PREGNANCY PRENATAL CARE BEGAN > [3] [Enter]RD

 

25BA. DATE LAST PRENATAL CARE VISIT > [9] [Enter]

09/09/2006 <-- ASSUMED DATE

 

25C. NUMBER OF PRENATAL VISITS > [12] [Enter]


AVSS Quick Reference Manual†††††††††††††††††††† †††††††††††††††††††††††††††††Hospital Birth Record, Register Birth Record (continued)

 

25D. PRINCIPAL SOURCE OF PAYMENT FOR PRENATAL CARE > [07] [Enter] = PRIVATE INSURANCE

 

Note: You may enter birthweight in pounds and ounces or grams.

26. BIRTHWEIGHT > [7 5.5] [Enter]

WEIGHT OF 7 POUNDS AND 5.5 OUNCES CONVERTED TO GRAMS: 3331

 

26A. OBSTETRIC ESTIMATION OF GESTATION AT DELIVERY - COMPLETED WEEKS > [35] [Enter]

 

26B. HEARING SCREENING > [N] [Enter]OT MED INDICATED

 

27A.†††† NUMBER OF LIVE BIRTHS NOW LIVING (EXCLUDING THIS CHILD) <0> [1] [Enter]

27B.††† NUMBER OF LIVE BIRTHS NOW DEAD <0> [Enter]

27C.††† DATE OF LAST LIVE BIRTH > [020302] [Enter]

02/03/2002 <-- ASSUMED DATE

 

CONVERTED TO 02/03/2002

27D.††† NUMBER OF MISCARRIAGES BEFORE 20 WEEKS <0> [1] [Enter]

27E.††† NUMBER OF MISCARRIAGES AFTER 20 WEEKS <0> [Enter]

27F.†††† MONTH AND YEAR OF LAST TERMINATION > [8 98] [Enter]

8/1998 <-- ASSUMED DATE

28AA. METHOD OF DELIVERY: FINAL DELIVERY ROUTE > [03] [Enter] = VAGINAL-SPONTANEOUS

 

28AC. METHOD OF DELIVERY: FETAL PRESENTATION AT BIRTH > [20] [Enter] = CEPHALIC FETAL PRESENTATION AT DELIVERY

 

28AD. METHOD OF DELIVERY: WAS VAGINAL DELIVERY WITH FORCEPS ATTEMPTED, BUT†††††

UNSUCCESSFUL? > [N] [Enter] 58 = NO

 

28AE. METHOD OF DELIVERY: WAS VAGINAL DELIVERY WITH VACUUM ATTEMPTED, BUT††††††

UNSUCCESSFUL? > [N] [Enter] 68 = NO

28B. PRINCIPAL SOURCE OF PAYMENT FOR DELIVERY > [07] Enter] = PRIVATE INSURANCE

 

29. COMPLICATION OF PREGNANCY AND CONCURRENT ILLNESSES

††††††††††††††††††††††††††††††††††††††††† > [51,52,53,54,55,56] [Enter]

†† ††51=††† CHLAMYDIA PRENATAL SCREENING DONE

†††† 52=††† GONORRHEA PRENATAL SCREENING DONE

†††† 53=††† GROUP B STREPTOCOCCAL INFECTION PRENATAL SCREENING DONE

†††† 54=††† HEPATITIS B PRENATAL SCREENING DONE

†††† 55=††† HUMAN IMMUNODEFICIENCY VIRUS PRENATAL SCREENING OFFERED

†††† 56=††† SYPHILIS PRENATAL SCREENING DONE

 

29. ANOTHER COMPLICATION OF PREGNANCY AND CONCURRENT ILLNESSES > [Enter]

30. COMPLICATIONS OF LABOR AND DELIVERY > [08,11] [Enter]

08=††† PROLONGED LABOR ( >=20 HOURS)

11=††† INDUCTION OF LABOR

30. ANOTHER COMPLICATIONS OF LABOR AND DELIVERY > [Enter]

 

31. ABNORMAL CONDITIONS AND CLINICAL PROCEDURES RELATING TO THE NEWBORN

††††††††††††††††††††††††††††††††††††††††††††††† > [NONE] [Enter]

 

32. FATHER'S SOCIAL SECURITY NUMBER > [123456789] [Enter]

 

33. MOTHER'S SOCIAL SECURITY NUMBER > [987654321] [Enter]

 

NEWS. INCLUDE THIS BIRTH IN NEWSPAPER REPORT? <N> [Enter]


AVSS Quick Reference Manual†††††††††††††††††††††††††††††††††††††††††††††††††† Hospital Birth Record, Register Birth Record (continued)

 

 

†††††††††††††††††††††††††††† HOSPITAL BIRTH RECORD

1A.JOHN†††††††††††††††††† 1B.PAUL†††††††††††† 1C.JONES

2.MALE††† 3A.SINGLE†† 3B.-†††††††† 4A.01/01/2007††††††† 4B.2253

5A.TEST HOSPITAL††††††††††††††† 5B.555 NORTH TEST LANE

5C.TEST CITY†††††††††† †††††††††5D.TEST COUNTY

6A.ROBERT†††††††† 6B.DAVID††††† 6C.JONES††††††††††† 7.AK†††††††††† 8.05/05/1939

9A.MARIA††††††††† 9B.ELENA††††† 9C.SANCHEZ†††††††† 10.MEXICO††††† 11.06/06/1980

MLN.JONES†††††††† 12A.JONES†††††††††††† 12B.MOTHER†††††††††††††† 12C.01/01/2007

14.†††††††††††††††††††††††††††††††††††† 13B.C-38381††††††††††††† 13C.††††††††††

13D.AAA AAA,MD,55 MAIN ST,GOLETA

15A.

19.NO††††††††††††††† 18.IRISH/JAPANESE/CHUMASH†††††††††††††††† 20C.12 ND

20.9/2006†† 20A.PROGRAMMER†††††††††††††††††††††† 20B.BANKING

22.MEXICAN†††††††††† 21.HISPANIC/SAMOAN††††††††††††††††††††††† 23C.BACHELOR'S

23.9/2006†† 23A.VICE-PRESIDENT††††††††††††††††††† 23B.BANKING

24A.4321 MAPLE STREET†††††††††††††††††††††††††††† 24B.LOS ANGELES

24C.LOS ANGELES††††††††††††††††† †††††††††††††††††24D.CA†††††††††††† 24E.90011

25A.04/--/2006 25AA.09/03/2006 25B.3RD25BA.09/09/2006 25C.12†††††† 25D.07

26.3331

26A.35††† GAWK.37.2E††† 27A.1††††† 27B.0††††††††† 27D.1††††††††† 27E.0

26B.NOT MED INDICATED†† 27C.02/03/2002††††††††††† 27F.08/1998

28A.03,0,20,58,68†† 28B.07††††††††††††† 29.51,52,53,54,55,56

 

HIT RETURN TO CONTINUE, Q OR ^Q TO QUIT > [Enter]

30.08,11††††††††††††††††††††††††††††††† 31.00

A.00 B. D.1 E. F.YY CT.†††††††††††††††† 32.123-45-6789††††††† 33.987-65-4321

MWT1.140††††††††††† MWT2.160††††††††††† MHT.5'7''††††† MAR.NO†††††††† DECP.YES

MSTREET.PO BOX 1065 MCITY.LOS ANGELES MSTATE.CA MZIP.90011 MCOUNTY.LOS ANGELES

CIGPN.0†††††††††††† CIGFN.0†††††††††††† CIGSN.0†††††††††††† MAGE.26

APGAR1.08†††††††††† APGAR5.09††† †††††††APGAR10.UNKNOWN

BPF.696†††††††††††† SENTHCA.††††††††††† NEWS.NO†† COM.

RSN.

 

 

HIT RETURN TO CONTINUE >

 

 

ATTEMPTING TO CENSUS TRACT

 

FATHER'S AGE (COMPUTED FROM FIELD 8) IS OUTSIDE

THE RANGE 15 THRU 64, INCLUSIVE.

 

VALIDATION: FAGE

THE STATE REGISTRAR REQUIRES THAT THE FOLLOWING

COMBINATION OF FIELD(S)/VALUE(S) BE VALIDATED:

FIELD: 8 = '05/05/1939'

FIELD: FAGE = '67'

HAVE YOU REFERRED TO THE ORIGINAL SOURCES AND ARE YOU SURE? <N> [Y] [Enter]

(F)ILE, (E)DIT, (V)ALIDATE, (D)ISPLAY, OR (P)RINT > [F] [Enter]

 

FILING HOSPITAL BIRTH RECORD ................

 

REGISTER ANOTHER <Y> [N] [Enter]

 

 

HOSPITAL BIRTH RECORD OPTION >


AVSS Quick Reference Manual†††††††††† ††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††Hospital Birth Record, Display Record

 

 

DISPLAY RECORD

 

You may display all the data on a previously filed record.AVSS will ask you to identify the person whose information you wish to display by the process known as "person selector".This process allows you to select a record by the file number or name. You may also display a record at any time while registering, editing, or completing a certificate using the '^D' command or F4 function key.

 

FOR RECORDS THAT HAVE NOT BEEN REGISTERED BY THE COUNTY:

SYSTEM OPTION > [H] [Enter] OSPITAL BIRTH RECORD

 

HOSPITAL BIRTH RECORD OPTION > [D] [Enter] ISPLAY RECORD

 

FILE# OR INDEX TO SEARCH > [Enter]

 

Note:†† Enter a "?" or use the F1 function key to display a list of the ways available to search for this person, such as by the date filed, or by the father's name.To select a search method, enter the first few characters of the displayed search methods.

 

lC. CHILD'S LAST NAME > [JONES] [Enter]

 

lA. CHILD'S FIRST NAME > [JO] [Enter]

 

lB. CHILD'S MIDDLE NAME > [Enter]

 

4A. DATE OF BIRTH > [Enter]

BEGINNING SEARCH...

(USE CTRL‑C TO TERMINATE SEARCH)

# INDEX VALUES††††† †††††† DATE†††††††††† FILE#††††† NEXT SKIPPED

------------------------------------------------------------------------------------

1) JONES, JOHN PAUL01/01/2007††† 696

IS THIS THE PERSON? <Y> [Enter]

RETRIEVING DATA .........

OUTPUT DEVICE <T> [Enter]

 

Note: Enter a 'P' as the output device if you would like your listing to print on your printer.

FOR RECORDS THAT HAVE BEEN REGISTERED BY THE COUNTY:

SYSTEM OPTION > [B] [Enter] IRTH CERTIFICATE

BIRTH CERTIFICATE OPTION > [D] [Enter] ISPLAY CERTIFICATE

FILE# OR INDEX TO SEARCH > [DR] [Enter]

††† (DR)HOSPITAL NUMBER DIRECTORY

I5A. HOSPITAL CODE > [000][Enter] Enter your three digit hospital code

If you donít know your code, use the last three digits in Box A of a certificate.

4A. DATE OF BIRTH > [010107] [Enter]

 

#INDEX VALUES†††††††††††††††††††††††† DATE††††† FILE#†††††††† NEXTSKIPPED

-------------------------------------------------------------------------------

1)000, 1/1/2007. . . . . . . . . . .††††††††††† 1200700000001

††† WILSON, CINDY ANN

2)000, 1/1/2007. . . . . . . . . . .††††††††††† 1200700000002

††† SMITH, JOHN JOE

PERSON # >


AVSS Quick Reference Manual††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††† Hospital Birth Record, Display Record (continued)

 

 

†††††††††††††††††††††††††††† HOSPITAL BIRTH RECORD

1A.JOHN†††††††††††††††††† 1B.PAUL†††††††††††† 1C.JONES

2.MALE††† 3A.SINGLE†† 3B.-†††††††† 4A.01/01/2007††††††† 4B.2253

5A.TEST HOSPITAL††††††††††††††† 5B.555 NORTH TEST LANE

5C.TEST CITY††††††††††††††††††† 5D.TEST COUNTY

6A.ROBERT†††††††† 6B.DAVID††††† 6C.JONES††††††††††† 7.AK†††††††††† 8.05/05/1939

9A.MARIA††††††††† 9B.ELENA††††† 9C.SANCHEZ†††††††† 10.MEXICO††††† 11.06/06/1980

MLN.JONES†††††††† 12A.JONES†††††††††††† 12B.MOTHER†††††††††††††† 12C.01/01/2007

14.†††††††††††††††††††††††††††††††††††† 13B.C-38381††††††††††††† 13C.01/01/2007

13D.AAA AAA,MD,55 MAIN ST,GOLETA

15A.

19.NO††††††††††††††† 18.IRISH/JAPANESE/CHUMASH†††††††††††††††† 20C.12 ND

20.9/2006†† 20A.PROGRAMMER††††††††††††††††††††††† 20B.BANKING

22.MEXICAN†††††††††† 21.HISPANIC/SAMOAN††††††††††††††††††††††† 23C.BACHELOR'S

23.9/2006†† 23A.VICE-PRESIDENT††††††††††††††††††† 23B.BANKING

24A.4321 MAPLE STREET†††††††††††††††††††††††††††† 24B.LOS ANGELES

24C.LOS ANGELES†††††††††††††††††††††††††††††††††† 24D.CA†††††††††††† 24E.90011

25A.04/--/2006 25AA.09/03/2006 25B.3RD25BA.09/09/2006 25C.12†††††† 25D.07

26.3331

26A.35††† GAWK.37.2E††† 27A.1††††† 27B.0††††††††† 27D.1††††††††† 27E.0

26B.NOT MED INDICATED†† 27C.02/03/2002††††††††††† 27F.08/1998

28A.03,0,20,58,68†† 28B.07††††††††††††† 29.51,52,53,54,55,56

 

HIT RETURN TO CONTINUE, Q OR ^Q TO QUIT > [Enter]

30.08,11††††††††††††††††††††††††††††††† 31.00

A.0000 B. D.1 E. F.YY CT.†††††††††††††††† 32.123-45-6789††††††† 33.987-65-4321

MWT1.140††††††††††† MWT2.160††††††††††† MHT.5'7''††††† MAR.NO†††††††† DECP.YES

MSTREET. MCITY. MSTATE. MZIP. MCOUNTY.

CIGPN.0†††††††††††† CIGFN.0†††††††††††† CIGSN.0†††††††††††† MAGE.26

APGAR1.08†††††††††† APGAR5.09†††††††††† APGAR10.10

BPF.696†††††††††††† SENTHCA.††††††††††† NEWS.NO†† COM.

RSN.

 

 

 

HOSPITAL BIRTH RECORD OPTION >


AVSS Quick Reference Manual†††††††††† ††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††Hospital Birth Record. Edit Record

 

 

EDIT RECORD

 

To change, edit, or correct information originally entered on a Certificate of Live Birth.AVSS will allow you to edit only those fields you need to change, one by one.After changing the data, you will be allowed to print and then re-file the data as a permanent record.If the fields do not have any data yet, because the record was filed before completion or the fields were skipped, use the option COMPLETE INCOMPLETE RECORD. If the paper certificate has already been sent to the health department, call them and have it sent back before editing the record.When editing a record a comment field can be entered.At the FIELD TO MODIFY > [COMM] [Enter]

 

CHANGING BABY'S FILE NUMBER

SYSTEM OPTION > [H] [Enter] OSPITAL BIRTH RECORD

 

HOSPITAL BIRTH RECORD OPTION > [E] [Enter] DIT RECORD

 

Note: Type the current file number of the baby.

 

FILE# OR INDEX TO SEARCH > [696] [Enter]

 

#NAME†††††††††††††† DATE††† †††††† FILE#†††† NEXT†††† †††† SKIPPED

------------------------------------------------------------------------------------

1)JONES, JOHN PAUL††† 01/01/2007696

IS THIS THE PERSON? <Y> [Enter]

 

Note: If you receive the warning ACCESS TO THIS CERTIFICATE IS RESTRICTED, please call your local county health department or the AVSS Help Desk at 916-449-5174 to release the record back to you.

 

FIELD(S) TO MODIFY > [BPF] [Enter]

 

Note:†† Type the correct file number for the baby.

 

BPF. BABY'S PATIENT FILE NUMBER <696> [6960] [Enter]

FIELD(S) TO MODIFY > [Enter]

 

F(ILE), E(DIT), V(ALIDATE), D(ISPLAY), OR P(RINT) > [F] [Enter]

 

FILING HOSPITAL BIRTH RECORD. . . . . . . . . .

EDIT ANOTHER <Y> [N] [Enter]

 

HOSPITAL BIRTH RECORD OPTION >

 

MODIFY FIELD(S)

HOSPITAL BIRTH RECORD OPTION > [E] [Enter] DIT RECORD

 

FILE# OR INDEX TO SEARCH> [6960] [Enter]

 

#NAME††† ††††††††††††† DATE††††††† FILE#†††† NEXT†††† SKIPPED

------------------------------------------------------------------------------------

1)JONES, JOHN PAUL†††††††† 01/01/2007†††† 6960

IS THIS THE PERSON? <Y> [Enter]

 

Note: If you receive the warning ACCESS TO THIS CERTIFICATE IS RESTRICTED, please call your local county Health Department or the AVSS Help Desk at 916-449-5174 to release the record back to you.


AVSS Quick Reference Manual††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††† Hospital Birth Record, Edit Record (continued)

 

Note:†† The following line illustrates the CONCATENATE command.

FIELD(S) TO MODIFY > [20A;25A] [Enter]

 

20A.†††† FATHER'S USUAL OCCUPATION > <PROGRAMMER> [SYSTEM MANAGER] [Enter]

 

25A.†††† DATE LAST NORMAL MENSES BEGAN <04/--/2006> [041206] [Enter]

04/12/2006 <-- ASSUMED DATE

CONVERTED TO 04/12/2006

 

GESTATIONAL AGE COMPUTED FROM LAST NORMAL MENSES: 37.5 WEEKS

FIELD(S) TO MODIFY > [9B] [Enter]

 

9B.†††††††††††† MIDDLE NAME OF MOTHER > <ELENA> [ALENA] [Enter]

FIELD(S) TO MODIFY > [Enter]

 

ATTEMPTING TO CENSUS TRACT

 

FATHERíS AGE (COMPUTED FROM FIELD 8) IS OUTSIDE

THE RANGE 15 THRU 64, INCLUSIVE

VALIDATION: FAGE

THE STATE REGISTRAR REQUIRES THAT THE FOLLOWING

COMBINATION OF FIELD(S)/VALUE(S) BE VALIDATED:

FIELD: 8 = Ď05/05/1939í

FIELD: FAGE = Ď67í

 

F(ILE), E(DIT), V(ALIDATE), D(ISPLAY), OR P(RINT) > [F] [Enter]

 

FILING HOSPITAL BIRTH RECORD. . . . . . . . . .

EDIT ANOTHER <Y> [N] [Enter]

 

 

HOSPITAL BIRTH RECORD OPTION >


AVSS Quick Reference Manual†††††††††† †††††††††††††††††††††††††††††††††††††††††††††††††††††††Hospital Birth Record, Alpha List of Records

 

 

ALPHA LIST OF RECORDS

 

To see those records registered into AVSS in alphabetical order by last name of child.AVSS allows you to list names within a specified alphabetic range.You will also choose a specific date range from beginning date of birth to ending date of birth.

 

SYSTEM OPTION > [H] [Enter] OSPITAL BIRTH RECORD

 

HOSPITAL BIRTH RECORD OPTION > [A] [Enter] LPHA LIST OF RECORDS

 

FROM <%> [ENTER]THRU <z> [Enter]

 

FROM EVENT DATE <1/1/06> [Enter]THRU EVENT DATE <TODAY> [ENTER]

 

RUN THIS REPORT IN THE BACKGROUND <N> [Enter]

 

SAVE THE OUTPUT FROM THIS REPORT <N> [Enter]

 

OUTPUT DEVICE <T> [Enter]

Note:†† Enter a 'P' as the output device if you would like your listing to print on your printer.

 

 

SITE: TEST HOSPITAL

HOSPITAL BIRTH RECORD ALPHA LIST FROM '%' THRU 'z',

FOR EVENT DATES 1/1/2006 THRU 9/29/2006

 

NAME††††††††††††††††††††††††††††††††† EVENT-DATE FILE#†† NEXT SKIPPED DATE-SENT

-------------------------------------------------------------------------------

LEHMAN, KAITLYN -†††††††††††††††††††† 4/01/2006123††††† 27C 13D

LEHMAN, KAZU -††††††††††††††††††††††† 6/05/2006456††††† 23A 28AA,††

MCCARROLL, ABBIE -††††††††††††††††††† 3/02/2006789††††† MAR 28AA,††

NISHIDA, ANDY -†††††††††††††††††††††† 4/02/2006987††††† 5E28AA,††

NISHIDA, MEEAH -††††††††††††††††††††† 4/02/2006654††††† 6A28AA††† 4/26/2006

TAYLOR, BOOBOO -††††††††††††††††††††† 6/11/2006321††††††††† 13D,13B 4/27/2006

TAYLOR, POOKIE -††††††††††††††††††††† 9/17/2006135††††† 18B 28AA,13D,13B,TYPE

MANN, MOE JOE†††††††††††††††††††††††† 2/1/2006†† 246††††††††† 14,†††† 4/26/2006

 

 

 

HOSPITAL BIRTH RECORD OPTION >


AVSS Quick Reference††††††††††††††††††††††††††††††† †††††††††††††††††††††††††††Manual Hospital Birth Record, Complete Incomplete Record

 

 

COMPLETE INCOMPLETE RECORD

 

This option is used for completing a birth certificate which has been filed before all of the required fields have been entered. This certificate could have been 'filed' as an INCOMPLETE FORM SAVED FOR LATER COMPLETION (using the key F6) at any time during data entry or it may contain fields which were 'skipped' (using the key F9) because the information was not available at the time of data entry.Data entry using this option will begin prompting you at the point which you 'filed' the record or will prompt you only for the fields which were 'skipped'. There is no need for you to remember where you 'filed' this record or which fields you previously 'skipped'.

 

INCOMPLETE RECORD

 

SYSTEM OPTION > [H] [Enter] OSPITAL BIRTH RECORD

 

HOSPITAL BIRTH RECORD OPTION > [C] [Enter] OMPLETE INCOMPLETE RECORD

 

FILE# OR INDEX TO SEARCH> [789] [Enter]

#NAME††† †††††††††††††††† DATE††† †††† FILE#†††† NEXT †††† SKIPPED

------------------------------------------------------------

1)MCCARROLL, ABBY†††††† 3/2/06††† 789†††††† MLN

IS THIS THE PERSON? <Y> [Enter]

RETRIEVING DATA .........

 

Note:†† AVSS will immediately begin at the field where you filed this record as anINCOMPLETE FORM ††††††††††††††††††††††††††††† SAVED FOR LATER COMPLETION.You can complete this record as usual.

 

 

SKIPPED FIELD(S)

 

SYSTEM OPTION > [H] [Enter] OSPITAL BIRTH RECORD

 

HOSPITAL BIRTH RECORD OPTION > [C] [Enter] OMPLETE INCOMPLETE RECORD

FILE# OR INDEX TO SEARCH> [4237] [Enter]

#NAME††† †††††††††††††††† DATE††† †††† FILE#†††† NEXT†††† SKIPPED

------------------------------------------------------------

1)MANN, MOE JOE†††††††† 2/1/06††† 246††††††††††††††† 1B,

IS THIS THE PERSON? <Y> [Enter]

RETRIEVING DATA .........

 

FIRST WE WILL REPROMPT ALL THE QUESTIONS PREVIOUSLY SKIPPED

"^FILE" HAS BEEN DISABLED, BUT IF YOU STILL WISH

TO DELAY ANSWERING YOU MAY "^SKIP" AGAIN.

 

Note:†† AVSS will immediately begin at the first skipped field.

1B.MIDDLE NAME OF CHILD > [IVAN] [Enter]

ALL THE PREVIOUSLY SKIPPED PROMPTS HAVE BEEN REPROMPTED

"^FILE" HAS BEEN ENABLED.

 

Note:†† AVSS will display this record.You can complete this record as usual.

 

 

HOSPITAL BIRTH RECORD OPTION >


AVSS Quick Reference Manual†††††††††† †††††††††††††††††††††††††††††††††††††††††††††††††††Hospital Birth Record, Incomplete Record Report

 

 

INCOMPLETE RECORD REPORT

 

This report will list all the records which were 'filed' during data entry as an INCOMPLETE FORM SAVED FOR LATER COMPLETION (using the key F6).

 

SYSTEM OPTION > [H] [Enter] OSPITAL BIRTH RECORD

 

HOSPITAL BIRTH RECORD OPTION > [INC] [Enter] OMPLETE RECORD REPORT

 

BEGINNING DATE <1/1/06> [Enter] (01/01/2006)

 

ENDING DATE <T> [Enter] (09/29/2006)

 

RUN THIS REPORT IN THE BACKGROUND <N> [Enter]

 

SAVE THE OUTPUT FROM THIS REPORT <N> [Enter]

 

OUTPUT DEVICE <T> [Enter]

 

Note:†† Enter a 'P' as the output device if you would like your listing to print on your printer.

 

 

INCOMPLETE CERTIFICATES FOR FORM:HOSPITAL BIRTH RECORD†††††††† SITE CODE: 123

INDEX††††††††† FILE#††††††††† SKIPPED

4237††††††††††††††††††††††††† 13C,

5720††††††††††††††††††††††††† 12C

6960††††††††††††††††††††††††† 12C,12C

6961††††††††††††††††††††††††† MLN

SUMMARY REPORT OF INCOMPLETE CERTIFICATES

SITE CODE: 123†††††††††††† FORM: HOSPITAL BIRTH RECORD

DATE RANGE: 01/01/2006 TO 09/29/2006

TOTAL NUMBER OF CERTIFICATES:10

NUMBER OF INCOMPLETE CERTIFICATES: 4

 

 

 

HOSPITAL BIRTH RECORD OPTION >


AVSS Quick Reference Manual†††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††† Hospital Birth Record, Filing Variable List

 

 

FILING VARIABLE LIST

 

This list will show all the records entered in AVSS for a date range specified by you.It will be sorted by the 'filing variable' or the baby's patient file number (BPF).This is the number assigned by you to identify this baby's record (e.g. the Medical Record Number).Record numbers which contain only numbers will be in a numerical order.Record numbers which contain non-numeric characters (letters and dashes) may be sorted differently and in a more alphabetical way.

 

SYSTEM OPTION > [H] [Enter] OSPITAL BIRTH RECORD

 

HOSPITAL BIRTH RECORD OPTION > [F] [Enter] ILING VARIABLE LIST

 

FROM FILE# <BEGIN> [Enter]†††† TO FILE# <END> [Enter]

 

RUN THIS LISTING IN THE BACKGROUND <N> [Enter]

 

SAVE THE OUTPUT FROM THIS PROGRAM <N> [Enter]

 

OUTPUT DEVICE <T> [Enter]

Note:†† Enter a 'P' as the output device if you would like your listing to print on your printer.

 

 

SITE:†† 123

HOSPITAL BIRTH RECORD INDEX LIST FROM '0' THRU '<END>'

NAME†††††††††††† †††††††††††††††††††††EVENT-DATE FILE#NEXTSKIPPED†††††† AMENDED

-------------------------------------------------------------------------------

BEHR, TEDI A††††††††††††††††††††††††† 1/2/2007†† 444††††††††††††††††††††††††††

JONES, HENRY ALAN†††††††††††††††† ††††4/17/2001654††† 19††††††††††††††††††††

PINCH, INA BEA††††††††††††††††††††††† 5/25/1993999††††††††† SSA1††††††††††††

RUTH, BABE††††††††††††††††††††††††††† 12/1/19881111†††††††††††††††††††††††††

GRANT, CARY G†††††††††††††††††††††††† 1/28/19941212†††††††† 25C,25D,††††††††

TEST, TEST TEST†††††††††††††††††††††† 12/20/1999 1234†† 20C†††††††††††††††††††

TEST, TEST TEST†††††††††††††††††††††† 12/9/19944321†††††††† 27C,27F,††††††††

CAINE, TEST MARK††††††††††††††††††††† 10/17/1995 5555†††††††† 27A,27B,27C,††††

JONES, JOHN PAUL††††††††††††††††††††† 1/1/2007†† 6960†††††††††††††††††††††††††

 

HIT RETURN TO CONTINUE, 'Q' OR '^Q' TO QUIT > [Enter]

JONES, DEAN RONALD††††††††††††††††††† 10/20/1999 7687†† 20A†††††††††††††††††††

POKIPSKY, YANCY LYNN†††††† †††††††††††5/29/198912345††††††† 27C,27F,††††††††

MANN, MOE JOE†††††††††††††††††††††††† 1/1/2007†† 13579††††††††††††††††††††††††

KIKO, ANDY CASEY††††††††††††††††††††† 3/4/2007†† 15937††††††††††††††††††††††††

NARY, MARY TERRY††††††††††††††††††††† 10/15/1996 23499††††††††††††††††††††††††

 

 

 

HOSPITAL BIRTH RECORD OPTION >


AVSS Quick Reference Manual†††††††††† †††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††Hospital Birth Record, Variable Display

 

 

VARIABLE DISPLAY

 

This display provides a list of field numbers and an expanded description of each field name.The field names are listed according to the sorting order of the data field number.It is possible to select only one data field or a group of data fields.This display is useful in analyzing record data in depth and also allows you to view the values of "internal variables" which are created during data entry for certain fields to be used in reports, computer tapes, or for mathematical computations.

 

SYSTEM OPTION > [H] [Enter] OSPITAL BIRTH RECORD

 

HOSPITAL BIRTH RECORD OPTION > [VAR] [Enter] IABLE DISPLAY

 

FILE# OR INDEX TO SEARCH> [6960] [Enter]

#NAME††† †††††††††††††† DATE††††† †††††† FILE#†††† NEXT†† SKIPPED

-------------------------------------------------------

1)JONES, JOHN PAUL†††††††† 01/01/20076960†††††††††††† 12B,13D,TYPE,23A,23B

IS THIS THE PERSON? <Y> [Enter]

 

EXAMPLE #1: To see all variables available on this form.

VARIABLE(S) > [*] [Enter]

 

2.SEX OF CHILD <MALE>

7.FATHER'S STATE OF BIRTH <AK>ALASKA

8.FATHER'S DATE OF BIRTH <05/05/25>

10.MOTHER'S STATE OF BIRTH <MEXICO>

10,RECHECK<>

11.MOTHER'S DATE OF BIRTH <06/06/66>

14.NAME AND TITLE OF CERTIFIER IF NOT ATTENDANT <>

18.FATHER'S RACE <ENGLISH/IRISH>

19.FATHER HISPANIC <NO>

21.MOTHER'S RACE <WHITE>

22.MOTHER HISPANIC <GUATEMALAN>

22,RECHECK <>

26.BIRTHWEIGHT <3331>

29.COMPLICATION OF PREGNANCY AND CONCURRENT ILLNESSES <00>†† NONE

30.COMPLICATIONS OF LABOR AND DELIVERY <00> NONE

31.ABNORMAL CONDITIONS AND CLINICAL PROCEDURES RELATING TO THE NEWBORN <00>NONE

HIT RETURN TO CONTINUE, 'Q' OR '^Q' TO QUIT > [Q][Enter]

 

 

 

HOSPITAL BIRTH RECORD OPTION >


AVSS Quick Reference Manual†††††††††††††††††††††††††††††††††††††††††††††††††††††††††† Hospital Birth Record, Variable Display(continued)

 

EXAMPLE #2: To see a list of the variables available.

VARIABLE(S) > [^L] [Enter]or [Press the F3 Key]

 

 

THE FOLLOWING VARAIBLES ARE AVAILABLE:

278101114181920212223262930313233%FILE

%UPDT%USAGE%VALD%VER12A12B12C13B13C13D15A18A18B

18C19L1A1B1C20A20B20C21A21B21C22L23A23B23C

24A24B24C24D24E25A25AA25B25BA25C25D26A26B27A

27B27C27D27E27F28A28AA28AB28AC28AD28AE28B3A3B

4A4B5A5B5C5D6A6B6C9A9B9CAAPGAR1APGAR10APGAR5

BBPFCIGFNCIGPNCIGSNCIGTNCNTYDDECPFFAGEGAGEGAWK

I10I11I12BI12CI13CI18I18AI18BI18CI19I21I21AI21B

I21CI22I24BI24CI24DI25AI25AAI25BAI27CI27FI3AI4A

I5AI5CI5DI7I8ICIGFNICIGPNICIGSNICIGTNIMCITYIMCOUNTY

IMSTATEISENTITYPEMAGEMARMCITYMCOUNTYMHTMLNMSTATEMSTRT

MWT1MWT2MZIPNCHSRESNEWSSENTSSA1SSA2TYPEWIC

 

 

 

 

EXAMPLE #3: To see the usage of a record

VARIABLE(S) > [%USAGE] [Enter]

 

 

 

%USAGE. (NOT ON FORM) <6@60352,60436,60139;6@60352,64822,64115;6@60352,66878,668

40;2@60457,34591,34562;>

%USAGE,0 <2>

%USAGE,1 <6@60352,66856,23C^GED^SOME COLLEGE>

%USAGE,2 <2@60457,34591,**SENT**>

 

 

 

VARIABLE(S) > [Enter]

 

HOSPITAL BIRTH RECORD OPTION >


AVSS Quick Reference Manual†††††††††† †††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††Hospital Birth Record, Index List Display

 

 

INDEX LIST DISPLAY

 

Provides a display of birth record information in a "list" format.The information is displayed in the same order that it was entered into the birth record.All of the codes or abbreviations used for fields such as in 28A-METHOD OF DELIVERY or 30-COMPLICATIONS AND PROCEDURES OF LABOR AND DELIVERY are translated so that these values may be viewed in their expanded form rather than as a code.

 

SYSTEM OPTION > [H] [Enter] OSPITAL BIRTH RECORD

HOSPITAL BIRTH RECORD OPTION > [INDE] [Enter] X LIST DISPLAY

FILE# OR INDEX TO SEARCH> [6960] [Enter]

#NAME††† ††††††††††††† DATE†††††††††† FILE#†††† NEXT†††† SKIPPED

-----------------------------------------------------------------------------

1)JONES, JOHN PAUL†† 01/01/2007†††† †††† 6960†††††††††††††† 12B,13D,TYPE,23A,23B

IS THIS THE PERSON? <Y> [Enter]

RETRIEVING DATA ..........

 

 

†††††††††††††††††††††††††††† HOSPITAL BIRTH RECORD

 

BPF†††† BABY'S PATIENT FILE NUMBER <6960>

1A††††† FIRST (GIVEN) NAME OF CHILD <JOHN>

1B††††† MIDDLE NAME OF CHILD <PAUL>

1C††††† LAST (FAMILY) NAME OF CHILD (SURNAME) <JONES>

2†††††† SEX OF CHILD <MALE>

3A††††† THIS BIRTH SINGLE, TWIN, ETC. <SINGLE>

4A††††† DATE OF BIRTH <01/01/2007>

4B††††† HOUR OF BIRTH (24 HOUR CLOCK) <2253>

MAR†††† MOTHER MARRIED (AT ANY TIME DURING THE PREGNANCY) <NO>

DECP††† DO YOU HAVE A DECLARATION OF PATERNITY SIGNED BY THE FATHER & MOTHER <YE

S>

6A††††† FIRST (GIVEN) NAME OF FATHER <ROBERT>

6B††††† MIDDLE NAME OF FATHER <DAVID>

6C††††† LAST (FAMILY) NAME OF FATHER (SURNAME) <JONES>

7†††††† FATHER'S STATE OF BIRTH <AK>ALASKA

8†††††† FATHER'S DATE OF BIRTH <05/05/1939>

9A††††† FIRST (GIVEN) NAME OF MOTHER <MARIA>

9B††††† MIDDLE NAME OF MOTHER <ALENA>

9C††† ††BIRTH LAST (FAMILY) NAME OF MOTHER (MAIDEN SURNAME) <SANCHEZ>

MLN†††† MOTHER'S CURRENT LAST NAME <JONES>

10††††† MOTHER'S STATE OF BIRTH <MEXICO>

 

HIT RETURN TO CONTINUE, Q OR ^Q TO QUIT >[Enter]

 

 

 

HOSPITAL BIRTH RECORD OPTION >


AVSS Quick Reference Manual††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††† Hospital Birth Record, Non-Confidential Display

 

 

NON-CONFIDENTIAL DISPLAY

 

The display of birth record information that is part of the public record of this birth.On a Certificate of Live Birth, the information displayed on the top part of the document (above the print CONFIDENTIAL INFORMATION FOR PUBLIC HEALTH USE ONLY) is considered non-confidential.

 

SYSTEM OPTION > [H] [Enter] OSPITAL BIRTH RECORD

 

HOSPITAL BIRTH RECORD OPTION > [NO] [Enter] N-CONFIDENTIAL DISPLAY

 

FILE# OR INDEX TO SEARCH> [6960] [Enter]

 

#NAME†††††††††††††† DATE††† †††††† FILE# †††††††††††† NEXT††† SKIPPED

------------------------------------------------------------------------------

1)JONES, JOHN PAUL††† 03/04/1993 6960††††††††††††† 12B,13D,TYPE,23A,23B

IS THIS THE PERSON? <Y> [Enter]

RETRIEVING DATA .........

OUTPUT DEVICE <T> [Enter]

Note:†† Enter a 'P' as the output device if you would like your listing to print on your printer.

 

 

†††††††††††††††††††††††††††† HOSPITAL BIRTH RECORD

1A.JOHN†††††††††††††††††† 1B.PAUL†††††††††††† 1C.JONES

2.MALE††† 3A.SINGLE†† 3B.-†††††††† 4A.01/01/2007††††††† 4B.2253

5A.TEST HOSPITAL††††††††††††††† 5B.555 NORTH TEST LANE

5C.TEST CITY†††††††††††††† †††††5D.TEST COUNTY

6A.ROBERT†††††††† 6B.DAVID††††† 6C.JONES††††††††††† 7.AK†††††††††† 8.05/05/1939

9A.MARIA††††††††† 9B.ALENA††††† 9C.SANCHEZ†††††††† 10.MEXICO††††† 11.06/06/1980

MLN.JONES†††††††† 12A.JONES†††††††††††† 12B.MOTHER†††††††††††††† 12C.01/01/2007

14.†††††††††††††††††††††††††††††††††††† 13B.C-38381††††††††††††† 13C.01/01/2007

13D.AAA AAA,MD,55 MAIN ST,GOLETA

15A.

19.NO

 

 

 

HOSPITAL BIRTH RECORD OPTION >


AVSS Quick Reference Manual††††††††††††††††††††††††††††††††††††††††††††††††† ††††††††††††††††††††††††††††Hospital Birth Record, Validation Display

 

 

VALIDATION DISPLAY

 

The list of validation and warning messages which would have appeared just before filing a birth record.†† A "validation" will require you to confirm the accuracy of the information that was entered.A "warning" will alert you to data that may be considered unlikely but a confirmation is not required.

 

SYSTEM OPTION > [H] [Enter] OSPITAL BIRTH RECORD

HOSPITAL BIRTH RECORD OPTION > [VAL] [Enter] IDATION DISPLAY

FILE# OR INDEX TO SEARCH> [6960] [Enter]

#NAME†††††††††††††††††††††††††††††††† DATE††††† FILE#†††††††† NEXTSKIPPED

-------------------------------------------------------------------------------

1)JONES, JOHN PAUL†† . . . . . . . .1/1/20076960††††† ††††††††††

 

IS THIS THE PERSON? <Y>

RETRIEVING DATA ................

 

OUTPUT DEVICE <T> [Enter]

Note:†† Enter a 'P' as the output device if you would like your listing to print on your printer.

 

 

VALIDATION MESSAGES:

 

 

ATTEMPTING TO CENSUS TRACT

 

FATHER'S AGE (COMPUTED FROM FIELD 8) IS OUTSIDE

THE RANGE 15 THRU 64, INCLUSIVE.

 

VALIDATION: FAGE

THE STATE REGISTRAR REQUIRES THAT THE FOLLOWING

COMBINATION OF FIELD(S)/VALUE(S) BE VALIDATED:

FIELD: 8 = '05/05/1939'

FIELD: FAGE = '67'

 

 

 

HOSPITAL BIRTH RECORD OPTION >


AVSS Quick Reference Manual†††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††† Hospital Birth Record, Individual Inquiry

 

 

INDIVIDUAL INQUIRY

 

A display of the "audit trail" for a particular birth record.This audit trail includes the name and date of the person who entered the original birth record and the names and dates of any other users who updated any data and refiled this record.

 

SYSTEM OPTION > [H] [Enter] OSPITAL BIRTH RECORD

HOSPITAL BIRTH RECORD OPTION > [INDI] [Enter] VIDUAL DISPLAY

FILE# OR INDEX TO SEARCH> [6960] [Enter]

 

#NAME†††††††††††††††††††††††††††††††† DATE††††† FILE#†††††††† NEXTSKIPPED

-------------------------------------------------------------------------------

1)JONES, JOHN PAUL†† . . . . . . . .1/1/20076960†††††††††††††††

 

IS THIS THE PERSON? <Y> [Enter]

 

 

ENTERED: NISHIDA,GLEN ON 1/01/2007UPDATED: NISHIDA,GLEN ON 1/01/2007

 

 

 

HOSPITAL BIRTH RECORD OPTION >


AVSS Quick Reference Manual†††††††††††††††††††††††††††††††† †††††††††††††††††††††††††††††††††††††††††††††††††††††††Hospital Birth Record, User Report

 

USER REPORT

 

The information provided on this report is to help keep statistics on the activities of all users and the types of activities for each birth record.Activities include entering, updating, and printing certificates and the time it takes to do each.A report can be printed in a summary format or all activities of each record can be displayed.The statistics for this report were gathered on the basis of the date of birth.

 

SYSTEM OPTION > [H] [Enter] OSPITAL BIRTH RECORD

HOSPITAL BIRTH RECORD OPTION > [US] [Enter]

1††† USER REPORT

2††† USER REPORT BY ACTIVITY INDEX

3††† USER SUMMARY

SELECTION # > [1] [Enter]

SEARCH DATA BY FILE NUMBER RANGE (F) OR DATE RANGE (D) <D> [Enter]

 

BEGINNING DATE <1/1/2006>††††† (1/1/2006)

††† ENDING DATE <TODAY>††††† (10/3/2006)

 

SUMMARY STATISTICS ONLY? <Y> [Enter]

 

RUN THIS REPORT IN THE BACKGROUND <N> [Enter]

 

SAVE THE OUTPUT FROM THIS REPORT <N> [Enter]

 

OUTPUT DEVICE <T> [Enter]*

Note:†† Enter a 'P' as the output device if you would like your listing to print on your printer.

 

LEHMAN,EMILY

ENTERED 1††† (AVG. ELAPSED TIME OF 16.40 N=1)

LINKED0

UPDATED 1††† (AVG. ELAPSED TIME OF 8.43 N=1)

PRINTED 0

 

MCCARROLL,JESSICA

ENTERED 7††† (AVG. ELAPSED TIME OF 8.48 N=7)

LINKED0

UPDATED 12†† (AVG. ELAPSED TIME OF 1.40 N=11)

PRINTED 0

 

NISHIDA,GLEN

ENTERED 0

LINKED0

UPDATED 6††† (AVG. ELAPSED TIME OF 1.58 N=6)

PRINTED 1††† (AVG. ELAPSED TIME OF 0.12 N=1)

 

*********************************************************************

 

TOTALS:

 

HIT RETURN TO CONTINUE, 'Q' OR '^Q' TO QUIT >

ENTERED 8††† (AVG. ELAPSED TIME OF 9.47 N=8)

LINKED0

UPDATED 19†† (AVG. ELAPSED TIME OF 1.85 N=18)

PRINTED 1††† (AVG. ELAPSED TIME OF 0.12 N=1)

 

THE TOTAL NUMBER OF ENTRIES WITH NO USAGE STATISTICS IS 0

THE TOTAL NUMBER OF ENTRIES WITH USAGE RECORDED IS 8


AVSS Quick Reference Manual††††††††††††††††††††††††††††††††††††††††††††††††††††††††† Hospital Birth Record, User Report By Activity Index

 

USER REPORT BY ACTIVITY INDEX

 

The information provided on this report is to help keep statistics on the activities of all users and the types of activities for each birth record.Activities include entering, updating, and printing certificates and the time it takes to do each.A report can be printed in a summary format or all activities of each record can be displayed.The statistics for this report were gathered based on the above mentioned activities occurring within the user-specified date range.

 

SYSTEM OPTION > [H][Enter]OSPITAL BIRTH RECORD

HOSPITAL BIRTH RECORD OPTION > [US][Enter]

1††† USER REPORT

2††† USER REPORT BY ACTIVITY INDEX

3††† USER SUMMARY

SELECTION # > [2] [Enter]††† USER REPORT BY ACTIVITY INDEX

 

BEGINNING DATE <1/1/2006> [040106] [Enter]†††† (4/1/2006)

††† ENDING DATE <TODAY> [043006] [Enter]†††† (4/30/2006)

 

SUMMARY REPORT ONLY <Y> [N] [Enter]

FULL AUDIT TRAIL? <Y> [Enter]

 

SAVE THE OUTPUT FROM THIS REPORT <N> [Enter]

 

OUTPUT DEVICE <T> [Enter]

Note:†† Enter a 'P' as the output device if you would like your listing to print on your printer.

 

SEARCHING DATABASE

 

USER REPORT FROM ACTIVITY INDEXING††††††††††††††† TODAY: 10/3/2006

DATE RANGE: FROM 4/1/2006 TO 4/30/2006

FORM: HOSPITAL BIRTH RECORD

 

4/3/2006 0 NEW CERTIFICATES WERE ENTERED

MCCARROLL,JESSICA UPDATED FILE # 999999 FROM 04:03 PM TO 04:04 PM TIME=0.77 MINU

TES

†††† AT 04:04 PM FIELD 14 CHANGED FROM '*UNDEF*' TO ''

MCCARROLL,JESSICA UPDATED FILE # 376 FROM 04:04 PM TO 04:04 PM TIME=0.40 MINUTES

 

4/13/2006 0 NEW CERTIFICATES WERE ENTERED

LEHMAN,EMILY UPDATED FILE # 999999 FROM 01:17 PM TO 01:17 PM TIME=0.52 MINUTES

 

4/20/2006 0 NEW CERTIFICATES WERE ENTERED

MCCARROLL,JESSICA UPDATED FILE # 481 FROM 01:49 PM TO 01:50 PM TIME=1.02 MINUTES

††† AT 01:50 PM *PUT ON LIST TO BE SENT*

MCCARROLL,JESSICA UPDATED FILE # 481 FROM 01:51 PM TO 01:51 PM TIME=0.85 MINUTES

†††† AT 01:51 PM *PROCESS REGISTRAR REFUSED*4/26/2006 0 NEW CERTIFICATES WERE ENTERED

MCCARROLL,JESSICA UPDATED FILE # 492 FROM 03:57 PM TO 03:58 PM TIME=0.38 MINUTES

 

MCCARROLL,JESSICA UPDATED FILE # 481 FROM 04:04 PM TO 04:05 PM TIME=0.28 MINUTES

†††† AT 04:05 PM *PUT ON LIST TO BE SENT*

NISHIDA,GLEN UPDATED FILE # 376 FROM 04:04 PM TO 04:05 PM TIME=0.47 MINUTES

†††† AT 04:05 PM FIELD COM CHANGED FROM '*UNDEF*' TO 'SENT BACK 4/26/06'
AVSS Quick Reference Manual††††††††††
†††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††Hospital Birth Record, User Summary

 

USER SUMMARY

 

This summary report contains a count of records by the date they were originally filed into AVSS (Record Count By Date of Registration) and also a count of the records that were most recently updated (Record Count By Last File Date) based on a user specified date range.

 

SYSTEM OPTION > [H] [Enter] OSPITAL BIRTH RECORD

HOSPITAL BIRTH RECORD OPTION > [US] [Enter]

1††† USER REPORT

2††† USER REPORT BY ACTIVITY INDEX

3††† USER SUMMARY

SELECTION # >[3][Enter]

 

BEGINNING DATE <1/1/2006> [040106] [Enter] (4/1/2006)

†† ENDING DATE <TODAY> [043006] [Enter] (4/30/2006)

 

RUN THIS REPORT IN THE BACKGROUND <N> [Enter]

 

SAVE THE OUTPUT FROM THIS REPORT <N>[Enter]

 

OUTPUT DEVICE <T> [Enter]

Note:†† Enter a 'P' as the output device if you would like your listing to print on your printer.

 

RECORD COUNT BY DATE OF REGISTRATION

 

04/27/2006†††††††††††††††††††††††††††† 1

--------------------------------------------------

TOTAL††††††††††††††††††††††††††††††††† 1

 

USER COUNT BY DATE OF REGISTRATION

 

MCCARROLL,JESSICA,SYSTEM†††††††††† ††††1

--------------------------------------------------

TOTAL††††††††††††††††††††††††††††††††† 1

 

RECORD COUNT BY LAST FILE DATE

 

04/26/2006†††††††††††††††††††††††††††† 3

04/27/2006†††††††††††††††††††††††††††† 1

--------------------------------------------------

TOTAL††††††††††††††††††††††††††††††††† 4

 

USER COUNT BY LAST FILE DATE

 

MCCARROLL,JESSICA,SYSTEM†††††††††††††† 3

NISHIDA,GLEN,AVSS PROJECT††††††††††††† 1

--------------------------------------------------

TOTAL††††††††††††††††††††††††††††††††† 4

 


AVSS Quick Reference Manual††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††† Hospital Birth Record, Print Record

 

 

PRINT RECORD

 

To print a baby's record.

SYSTEM OPTION > [H] [Enter] OSPITAL BIRTH RECORD

HOSPITAL BIRTH RECORD OPTION > [PRI] [Enter] NT RECORD

 

FILE# OR INDEX TO SEARCH > [6960] [Enter]

 

#NAME†††††††††††††††††††††††††††††††† DATE††††† FILE#†††††††† NEXTSKIPPED

-------------------------------------------------------------------------------

1)JONES, JOHN PAUL†† . . . . . . . .1/1/20076960†††††††††††††††

 

IS THIS THE PERSON? <Y> [Enter]

 

OUTPUT DEVICE <P> [Enter]

 

HOSPITAL BIRTH RECORD OPTION >


AVSS Quick Reference Manual†††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††† Hospital Birth Record, Scratch Record

 

 

SCRATCH RECORD

 

To remove a babyís record, whether itís a duplicate or mistake, please contact your local Health Department or the AVSS Help Desk at 916-449-5174.


AVSS Quick Reference Manual†††††††††† ††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††Hospital Birth Record, Modify User Lists

 

 

MODIFY USER LISTS

 

Please see HOSPITAL BIRTH RECORD OPTION, ATTENDANT LIST for additions, changes, and deletions to an attendant.This suboption may be used to add, change, delete or list user-defined attendants, or certifiers, etc.Keeping this list current reduces the amount of time you may spend typing in this repetitive data.

 

ADDING A NEW CERTIFIER/ATTENDANT NAME

SYSTEM OPTION > [H] [Enter] OSPITAL BIRTH RECORD

 

HOSPITAL BIRTH RECORD OPTION > [M] [Enter] ODIFY USER LISTS

 

CALIST. LIST TO EDIT > [^L] [Enter] or [Press the F3 key]

 

ATTENDANT LIST (MD)

CERTIFIER LIST(ADMIN)

REPORTER LIST

PEDIATRICIAN LIST

PRENATAL CARE PROVIDER LIST

DELIVERY NURSE LIST

FUNERAL DIRECTOR LIST

EMBALMER LIST

DISPOSTION LIST

CERTIFIER LIST (DEATHS)

CORONER LIST

 

CALIST. LIST TO EDIT > [CE][Enter]

1.††††††††††††††††††††† CERTIFIER LIST (ADMIN)

2.††††††††††††††††††††† CERTIFIER LIST (DEATHS)

 

SELECTIONS # > [1] [Enter]CERTIFIER LIST (ADMIN)

 

CACE. ATTENDANT'S LAST NAME > [PATILLO] [Enter]

CAFN. FIRST NAME > [ELIZABETH] [Enter]

CAMI. MIDDLE INITIAL > [R] [Enter]

CATI. CERTIFIER TITLE > [MED REC CLK] [Enter]

PATILLO,ELIZABETH R,MED REC CLK

1234567890123456789012345678901

 

Note:†† If you receive the following message:

*** WARNING *** THIS ENTRY IS TOO LONG (MAX=26).

PLEASE EDIT THE ITEMS AND REMOVE 5 CHARACTERS.

 

Note:†† AVSS will re-prompt you for the certifier's data, allowing you to make the necessary changes.


AVSS Quick Reference Manual††††††††††††††††††††††††††††††††††††††††††††††††††††††††† Hospital Birth Record, Modify User Lists (continued)

 

 

EDITING A CERTIFIER'S/ATTENDANT'S INFORMATION

 

Please see HOSPITAL BIRTH RECORD OPTION, ATTENDANT LIST for changes to an attendant.If you need to make minor changes in a certifier's information, such as replacing, inserting or deleting a few characters, follow the instructions below.However, if there are major changes, it is usually easier to completely delete the old information (see†††††† HOSPITAL BIRTH RECORD OPTION, MODIFY USER LISTS, DELETING A CERTIFIER/ATTENDANT) and then completely re-enter the new information (see HOSPITAL BIRTH RECORD OPTION, MODIFY USER LISTS, ADDING A NEW CERTIFIER/ATTENDANT NAME).

 

SYSTEM OPTION > [H] [Enter] OSPITAL BIRTH RECORD

 

HOSPITAL BIRTH RECORD OPTION > [M] [Enter] ODIFY USER LISTS

 

CALIST. LIST TO EDIT > [CE][Enter]

1.††††††††††††††††††††† CERTIFIER LIST (ADMIN)

2.††††††††††††††††††††† CERTIFIER LIST (DEATHS)

SELECTIONS # >[1][Enter]†††††††††† CERTIFIER LIST (ADMIN)

 

CACE. CERTIFIER'S LAST NAME > [PA][Enter]

Note:†† You may type the first two or three letters of the certifier's last name.

IS THIS THE PERSON <Y>[Enter]

 

PA1†† =PATILLO,ELIZABETH R,MR CLK

PA1 ††††† =

 

Note:†† First use the space bar to move the cursor so it is directly underneath the character(s) you want to replace or delete, or just in front of where you want to insert new characters.Type one of the following codes::

I†††† (Insert)

R††† (Replace)

D††† (Delete)

Refer to the following examples:

EXAMPLE #1, Inserting Characters

PA1†† =PATILLO,ELIZABETH,MR CLK

PA1†† =†††††††††††††††††††††† †††††IED [Enter]

 

PA1†† =PATILLO,ELIZABETH,MEDR CLK

PA1†† = [Enter]

 

EXAMPLE #2, Replacing Characters:

PA1†† =PATILLO,ELIZABETH,MEDR CLK

PA1†† =†††††††††††††††† RS††††††††††††††††††††††††† [Enter]

PA1†† =PATILLO,ELISABETH T,MEDR CLK

PA1†† =[Enter]

 

EXAMPLE #3, Deleting Characters:

PA1†† =PATILLO,ELISABETH,MEDR CLK

PA1†† =††††††††† ††D D D D ††[Enter]

PA1†† =PATILLO,BETH,MEDR CLK

PA1†† =[Enter]


AVSS Quick Reference Manual†††††††††† ††††††††††††††††††††††††††††††††††††††††††††††Hospital Birth Record, Modify User Lists (continued)

 

 

LIST CERTIFIERS/ATTENDANTS

 

SYSTEM OPTION > [H] [Enter] OSPITAL BIRTH RECORD

 

HOSPITAL BIRTH RECORD OPTION > [M] [Enter] ODIFY USER LISTS

 

CALIST. LIST TO EDIT > [CE][Enter]

1.††††††††††††††††††††† CERTIFIER LIST (ADMIN)

2.††††††††††††††††††††† CERTIFIER LIST (DEATHS)

SELECTIONS # > [1] [Enter]†††††† CERTIFIER LIST (ADMIN)

 

CACE. CERTIFIER'S LAST NAME > [^L] [Enter] or [Press the F3 Key]

OUTPUT DEVICE <T>

Note:†† Enter a 'P' as the output device if you would like your listing to print on your printer.

 

 

JO0 = JONES,SANDRA,BIRTH CLERK

PA0 = PATILLO,BETH,MEDR CLK

SM0 = SMITH,JANE T,MR DIRECTOR

TW0 = TWOMNE,OLGA,MR DIRECTOR

 

 

CACE. CERTIFIER'S LAST NAME > [Enter]

CALIST.LIST TO EDIT > [Enter]

HOSPITAL BIRTH RECORD OPTION >


AVSS Quick Reference Manual††††††††††††††††††††††††††††††††††††††††††††††††††††††††† Hospital Birth Record, Modify User Lists (continued)

 

 

DELETING A CERTIFIER/ATTENDANT

 

SYSTEM OPTION > [H][Enter] OSPITAL BIRTH RECORD

 

HOSPITAL BIRTH RECORD OPTION > [M] [Enter] ODIFY USER LISTS

 

CALIST. LIST TO EDIT > [CE] [Enter]

1. CERTIFIER LIST (ADMIN)

2. CERTIFIER LIST (DEATHS)

 

SELECTIONS # > [1] [Enter] CERTIFIER LIST (ADMIN)

 

CACE. CERTIFIER'S LAST NAME > [TW][Enter] OMNE,OLGA,MR DIRECTOR

IS THIS THE PERSON <Y>[Enter]

TW0††† =TWOMNE,OLGA,MR DIRECTOR

TW0††† =[K] [Enter]††††††††††† OK TO DELETE? [Y] [Enter]

CACE. CERTIFIER'S LAST NAME > [Enter]

 

CALIST. LIST TO EDIT > [Enter]

 

HOSPITAL BIRTH RECORD OPTION >

 


AVSS Quick Reference Manual††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††† Hospital Birth Record, Attendant List

 

 

ATTENDANT LIST

 

To add, change, delete or list the Attendants (field 13D) that are specific to your facility.Maintaining a current list of your attendants reduces the amount of time you may spend typing in this repetitive data.

 

ADDING A NEW ATTENDANT

SYSTEM OPTION > [H] [Enter] OSPITAL BIRTH RECORD

 

HOSPITAL BIRTH RECORD OPTION > [AT] [Enter] TTENDANT LIST

 

ATTENDANT LIST FUNCTION > [^L] [Enter]

 

ENTER†††† 'A'†† TO ADD A NEW ATTENDANT,

'L'TO LIST THE ATTENDANTS,

'E'TO EDIT AN ATTENDANT,

'D'TO DELETE AN ENTRY.

 

ATTENDANT LIST FUNCTION > [A] [Enter]

 

LAST NAME > [HARVEY] [Enter]

FIRST NAME > [PAUL] [Enter]

TITLE > [MD] [Enter] (1) M.D. (MEDICAL DOCTOR OR MD) (1)

ADDRESS > [123 MAIN ST] [Enter]

CITY > [MONTCLAIR] [Enter]

LICENSE NUMBER > [A12345] [Enter]

ADDED:††† HARVEY,PAUL,MD,123 MAIN ST,MONTCLAIR;;A12345;1

 

Note:†† If you receive the following message, AVSS will re-prompt you for the Attendant's data, allowing you to make the necessary changes:

NAME/ADDRESS INFORMATION TOO LONG BY X CHARACTERS.

ABBREVIATE AS NECESSARY.

 

LIST ATTENDANTS

ATTENDANT LIST FUNCTION > [L] [Enter] IST

 

OUTPUT DEVICE <T> [Enter]

 

BARBOSA,JUAN,MD,810 EAST CHASTAIN,SAN FERNANDO††††††††††††††††††††††††††††† A-32474

BOWLES,NANCY C,CNM,2311 N STATE ST,LOS ANGELES†††††††††††††††††††††††††††††† 434

CALLAHAN,THADDEUS,MD,222 S PALISADE DR,VAN NUYS†††††††††††††††††††††††††††† G-62123

HARVEY,PAUL,MD,123 MAIN ST,MONTCLAIR†††††††††††††††††††††††††††††††††††††††††††††††††††††††† A12345

JURATSCH,CLYDE,MD,65 SHERMAN WAY,RESEDA††††††††††††††††††††††††††††††††††††††††††† G-07772

JUSTIN,JOHN,MD,810 EAST CHASTAIN,SAN FERNANDO††††††††††††††††††††††††††††††††† A42424

MARSHALL,PEGGY,MD,14200 SANTA MONICA,SANTA MONICA††††††††††††††††††††††† A-34210

MCGHEE,MICHAEL,MD,1300 CYPRESS,VAN NUYS†††††††††††††††††††††††††††††††††††††† C-09318

OKERBLUM,MORRIS,MD,210 COLLEGE DRIVE,NORTHRIDGE††††††††††††††††††††††† A92821

SPENCER,TRUDY,MD,65 SHERMAN WAY,RESEDA†††††††††††††††††††††††††††††††††††††† A-82739

SPUDS,IDA,14200 SANTA MONICA,SANTA MONICA†††††††††††††††††††††††††††††††††††††† C-21828

WYATT,MITCHELL,MD,1300 CYPRESS,VAN NUYS††††††††††††††††††††††††††††††††††††††††††††††† G-18283

 


AVSS Quick Reference Manual††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††† Hospital Birth Record, Attendant List (continued)

 

 

EDIT AN ATTENDANT

 

SYSTEM OPTION > [H] [Enter] OSPITAL BIRTH RECORD

 

HOSPITAL BIRTH RECORD OPTION > [AT][Enter]TTENDANT LIST

 

ATTENDANT LIST FUNCTION > [E] [Enter]††††† DIT

ATTENDANT'S LAST,FIRST NAME > [HAR][Enter]

 

SEARCHING ATTENDANT LIST...

 

1††† HARVEY,PAUL,MD,123 MAIN ST,MONTCLAIR†††††††††††††††††† A12345

 

IS THIS THE ATTENDANT <Y>[Enter]

Note:†† Make changes to any fields, as necessary:

 

LAST NAME <HARVEY> [Enter]

FIRST NAME <PAUL> [Enter]††††

TITLE <MD> [FIR] [Enter] (6) FIREMAN (C.P.T. CERTIFIED) (6)

ADDRESS<123 MAIN ST> [Enter]

CITY <MONTCLAIR>

LICENSE NUMBER <A12345> [FM843] [Enter]

 

REMOVED:HARVEY,PAUL,MD,123 MAIN ST,MONTCLAIR;;A12345;1

ADDED:HARVEY,PAUL,FIREMAN,123 MAIN ST,MONTCLAIR;;FM843;6

 

ATTENDANT LIST FUNCTION >

 

DELETING AN ATTENDANT

ATTENDANT LIST FUNCTION > [D] [Enter]††††† ELETE

 

ATTENDANT'S LAST,FIRST NAME > [HAR] [Enter]

 

1††† HARVEY,PAUL,MD,123 MAIN ST,MONTCLAIR†††††††††††††††††† A12345

IS THIS THE ATTENDANT <Y> [Enter]

DELETE HARVEY,PAUL,FIREMAN

ARE YOU SURE <N> [Y] [Enter]

DELETED.

 

ATTENDANT LIST FUNCTION >


AVSS Quick Reference Manual††††††††††††††††††††††††††††††††††††††††††††† Hospital Birth Record, Process Registrar Refused Records

 

 

PROCESS REGISTRAR REFUSED RECORDS

 

To allow access to a record that has been previously restricted.A record that has been selected for the LIST TO BE SENT TO HEALTH DEPARTMENT is flagged as 'SENT' and access to this record becomes restricted.The message ACCESS TO THIS CERTIFICATE IS RESTRICTED is displayed when you try to edit or print a record that has been selected for the LIST TO BE SENT TO HEALTH DEPARTMENT.Make sure you have the paper birth certificate back from the health department and ask them to release the record or call the AVSS Help Desk at 916-449-5174..

 


AVSS Quick Reference Manual†††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††† Hospital Birth Record, VerificationLetter

 

 

VERIFICATION LETTER

 

A complimentary letter provided to parents by the hospital.This is not a legal document.The letter contains non-confidential birth information.The standard AVSS Verification Letter may be printed on plain white paper, or a customized Verification Letter can be printed using hospital letterhead or any other stationery of your choice.

 

FOR RECORDS THAT HAVE NOT BEEN REGISTERED BY THE COUNTY:

 

SYSTEM OPTION > [H] [Enter] OSPITAL BIRTH RECORD

 

HOSPITAL BIRTH RECORD OPTION > [VE] [Enter] RIFICATION LETTER

 

FILE# OR INDEX TO SEARCH> [5542] [Enter]

#NAME††† †††††††††††††††† DATE†††††††† FILE#†† NEXT†† SKIPPED

------------------------------------------------------------

1)BACON, EMILY JOY††††† 02/28/2006†† 5542

 

IS THIS THE PERSON? <Y> [Enter]

 

OUTPUT DEVICE <P> [Enter]

 

HOSPITAL BIRTH RECORD OPTION >

 

FOR RECORDS THAT HAVE BEEN REGISTERED BY THE COUNTY:

SYSTEM OPTION > [B] [Enter] IRTH CERTIFICATE

BIRTH CERTIFICATE OPTION > [H] [Enter] OSPITAL VERIFICATION LETTER

FILE# OR INDEX TO SEARCH > [DR] [Enter]

††† (DR)HOSPITAL NUMBER DIRECTORY

I5A. HOSPITAL CODE > [000][Enter] Enter your three digit hospital code

If you donít know your code, look in Box A of a certificate.

4A. DATE OF BIRTH > [010107] [Enter]

OUTPUT DEVICE <P> [Enter]

BIRTH CERTIFICATE OPTION >


AVSS Quick Reference Manual†††††††††††††††††††††††††††††††††††††††††††††††††††††††† Hospital Birth Record, Verification Letter (continued)

 

 

Note:†† Sample of letter with your hospital letterhead.

 

 

 

 

 

 

†††††††††††††††† AVSS TEST HOSPITAL

††††††††††††††††††††††††††††††††††††††† 123 Main St.

††††††††††††††††††††††††††††††††††††††† Santa Monica, Califonia

_____________________________________________________________

 

 

 

 

†††† OUR MEDICAL RECORDS INDICATE THAT THE FOLLOWING CHILD:

 

†††††††††††††††††††††††††††††††† EMILY††† JOY††††††† BACON

 

†††† WAS BORN IN THIS FACILITY

 

†††† ON FEBRUARY 28, 2006AT†† 0837 HOURS

 

†††† MOTHER'S MAIDEN NAME:†††††† GINAMARIE†† CALLAHAN

†††† MOTHER'S BIRTH PLACE:†††††††† CALIFORINIA†††††† DOB:††† 12/23/80

 

†††† FATHER'S NAME:†††††††††††††††††††††† WILLIAM ARTHUR BACON

†††† FATHER'S BIRTH PLACE:††††††††† MICHIGAN†††††††††† DOB:††† 1/9/79

 

†††† SEX OF CHILD:†††† FEMALE

 

†††† BIRTH ATTENDANT:††††††††††† NANCY C BOWLES, CNM

 

 

 

 

 

†††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††† __________________________

†††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††† HOSPITAL REPRESENTATIVE

 

 

 


NameAVSS Quick Reference Manual††††††††††††††††††††††††††††††††††† †††Hospital Birth Record, Duplicate Record Report Based On

 

 

DUPLICATE RECORD REPORT BASED ON NAME

 

This report will list babies who might possibly have been entered more than once.The report looks at the babiesí name and the date of birth to make this determination.

 

SYSTEM OPTION > [H] [Enter] OSPITAL BIRTH RECORD

 

HOSPITAL BIRTH RECORD OPTION > [DUP] [Enter] LICATE RECORD REPORT BASED ON NAME

 

FROM <%> [ENTER]THRU <z> [Enter]

FROM EVENT DATE <1/1/06> [Enter] THRU EVENT DATE <TODAY> [ENTER]

 

RUN THIS REPORT IN THE BACKGROUND <N> [Enter]

 

SAVE THE OUTPUT FROM THIS REPORT <N> [Enter]

 

OUTPUT DEVICE <T> [Enter]

Note:†† Enter a 'P' as the output device if you would like your listing to print on your printer.

 

LAST, FIRST MIDDLE†††††††††††††† DATE†††††††††††††† FILE #†††††††††††††† ORDER/MULT

-----------------------------------------------------------------------------------

CHICKEN, MARK LOUIS††††††††††††† 3/20/06††††††††††† 8383†††††††††††††††††††† ?/1

CHICKEN, MARK LOUIS††††††††††††† 3/20/06††††††††††† 8384†††††††††††††††††††† ?/1

 

HOSPITAL BIRTH RECORD OPTION >

 


AVSS Quick Reference Manual††††††††††††††††††††††††††††††††††††††††††††††††††††† Hospital Birth Record, List To Be Sent To Health Dept

 

 

LIST TO BE SENT TO HEALTH DEPARTMENT

 

The completed Hospital Birth Records are sent to the Local Registration District.A listing of the completed records can be created to send with the certificates.This listing is created from the records that have not yet been batched and are still flagged as "UNSENT".This list provides you with an audit trail of the records you have sent to your Local Registration District and the date that they were completed and sent.A record that has been selected for this list is flagged as 'SENT' and access to this record becomes restricted.The message ACCESS TO THIS CERTIFICATE IS RESTRICTED is displayed when you try to edit or print a record that has been previously put on a list.(See PROCESS REGISTRAR REFUSED RECORDS)

 

Note: After the record has been registered by the local Health Department, itís removed permanently from the list and you will not be able to reprint a list from the past.

 

SELECTING RECORDS FOR LIST

SYSTEM OPTION > [H] [Enter] OSPITAL BIRTH RECORD

 

HOSPITAL BIRTH RECORD OPTION > [L] [Enter] IST TO BE SENT TO HEALTH DEPARTMENT

 

THIS OPTION CAN CREATE A NEW LIST TO BE SENT TO THE HEALTH DEPARTMENT OR

RE-PRINT A REPORT FROM THE PAST.

CREATE NEW LIST <Y> [Enter]

 

ENTER S)ELECT, D)ISPLAY, P)RINT, OR Q)UIT > [Enter]

S:†† SELECT RECORDS TO BE INCLUDED/EXCLUDED IN THE LIST

D:DISPLAY RECORDS CURRENTLY IN THE LIST

P:†† PRINT THE LIST

NOTE: RECORDS WILL BE MARKED AS 'SENT' ONLY AFTER BEING PRINTED.

Q:QUIT THIS FUNCTION AND RETURN TO THE SUB-OPTION MENU.

 

ENTER S)ELECT, D)ISPLAY, P)RINT, OR Q)UIT >[S][Enter]†††

 

# SEX LAST, FIRST MIDDLE††††††††††††††††††† EVENT-DATEFILE#SKIPPED

--------------------------------------------------------------------------------

1 F†† VASQUEZ,MARRINA JASMINE††† †††††††††††††† 3/1/06††††† 5720

INCLUDE (Y/N/Q)<N> [Y] [Enter] RECORD INCLUDED

2 F†† VINING,SHANTELL TRANICE††††† †††††††††††††† 3/2/06††††† 6500

INCLUDE (Y/N/Q)<N> [Y] [Enter] RECORD INCLUDED

3 M†† JONES,JOHN PAUL†††††††††††††††††††††† 3/4/06††††† 6960†† 12B,13D,TYPE,23A,23B

INCLUDE (Y/N/Q)<N> [Y] [Enter] RECORD INCLUDED

4 F†† ALEXANDER,JANE MARIE††††††††††††††††† 3/7/06††††† 6961

INCLUDE (Y/N/Q)<N> [Enter]

NO MORE UNSENT RECORDS.

 

 

DISPLAYING RECORDS ON LIST

Note: Display the records you have selected before printing the final list.After selecting the records as explained above, continue with the display option as follows:.

ENTER S)ELECT, D)ISPLAY, P)RINT, OR Q)UIT > [D] [Enter]

 


AVSS Quick Reference Manual†††††††††††††††††††††††††††††††††† Hospital Birth Record, List To Be Sent To Health Dept. (continued)

 

 

ALPHABETIC LIST FOR AVSS TEST HOSPITAL††††††††††††††††††††††††††††††† DATE:†† 3/8/06

# SEX LAST,†† FIRST†† MIDDLE†††† EVENT-DATE†††††††††† FILE#††††† ††† SKIPPED

------------------------------------------------------------------------------------

1 F†† VASQUEZ,MARRINA JASMINE†††† 3/1/06†††††††††††††† 5720

2 F†† VINING,SHANTELL TRANICE†††† 3/2/06†††††††††††††† 6500

3 M†† JONES,JOHN PAUL†††††††††††† 3/4/06†††††††††† ††††6960†††† 12B,13D,TYPE,23A,23B

 

 

 

REMOVING RECORDS FROM LIST

 

Note: If after the records have been displayed, there is a record you wish to remove, continue as follows.All unsent records will be listed again and you will choose the records that should be included in the list.

 

ENTER S)ELECT, D)ISPLAY, P)RINT, OR Q)UIT > [S] [Enter]

 

# SEX†† LAST,†† FIRST†† MIDDLE††††††††††††††† EVENT-DATEFILE#SKIPPED

---------------------------------------------------------------------------

1 F†† VASQUEZ,MARRINA JASMINE††† †††††††††††††† 3/1/06††††† 5720

INCLUDE (Y/N/Q)<N> [Y] [Enter] RECORD INCLUDED

2 F†† VINING,SHANTELL TRANICE††††† †††††††††††††† 3/2/06††††† 6500

INCLUDE (Y/N/Q)<N> [Y] [Enter] RECORD INCLUDED

3 M†† JONES,JOHN PAUL†††††††††††††††††††††† 3/4/06††††† 6960†† 12B,13D,TYPE,23A,23B

INCLUDE (Y/N/Q)<N> [Enter]

4 F†† ALEXANDER,JANE MARIE††††††††††††††††† 3/7/06††††† 6961

INCLUDE (Y/N/Q)<N> [Enter]

NO MORE UNSENT RECORDS.

 

Note:†† Display the selected records again, then continue with printing the final list.Once this list has been††††††††††† printed, records will be marked as 'sent' and cannot be removed from the list.

 

 

PRINTING RECORDS ON LIST

ENTER S)ELECT, D)ISPLAY, P)RINT, OR Q)UIT > [P] [Enter]

OUTPUT DEVICE <P> [Enter]

 

 

ALPHABETIC LIST FOR AVSS TEST HOSPITAL††††††††††††††††††††††††††††††† DATE:†† 3/8/06

# SEX LAST,†† FIRST†† MIDDLE†††† EVENT-DATE†††††††††† FILE#††††† ††† SKIPPED

------------------------------------------------------------------------------------

1 F†† VASQUEZ,MARRINA JASMINE†††† 3/1/06†††††††††††††† 5720

2 F†† VINING,SHANTELL TRANICE†††† 3/2/06†††††††††††††† 6500

 

 

 

ENTER S)ELECT, D)ISPLAY, P)RINT, OR Q)UIT > [Q] [Enter]

 

HOSPITAL BIRTH RECORD OPTION >


AVSS Quick Reference Manual†††††††††† ††††††††††††††††††††††††††††††††††††††††††††††††††Hospital Birth Record, Generate Hospital CBC File

 

 

GENERATE HOSPITAL CBC FILE

 

This option will allow you to create an ASCII file of your hospital records.You may ask your local Health Department or the AVSS Help Desk to create the file for you, since the file will be saved on the AVSS Server and downloaded via AVSS FX application.

 


AVSS Quick Reference Manual††††††††††††††††††††††††† ††††††††††††††††††††Hospital Birth Record, Hospital Unsent List Of Incompletes

 

 

HOSPITAL UNSENT LIST OF INCOMPLETES

 

A report listing records which are not complete and ready to be added to the LIST TO BE SENT TO THE HEALTH DEPT.

 

SYSTEM OPTION > [H] [Enter] OSPITAL BIRTH RECORD

 

HOSPITAL BIRTH RECORD OPTION > [HO] [Enter] SPITAL UNSENT LIST OF INCOMPLETES

 

ENTER BEGINNING VALUE FOR DATE OF BIRTH <1/1/06> [Enter](1/1/06)

ENTER†††††† ENDING VALUE FOR DATE OF BIRTH <T> [Enter](4/1/06)

 

RUN THIS REPORT IN THE BACKGROUND <N> [Enter]

 

SAVE THE OUTPUT FROM THIS REPORT <N> [Enter]

OUTPUT DEVICE <T> [Enter]

Note:†† Enter a 'P' as the output device if you would like your listing to print on your printer.

 

INCOMPLETE RECORDS NOT SENT TO HEALTH DEPARTMENT

RAN ON: 4/1/06 BY: JONES,SANDRA,BIRTH CLERK FOR DATES OF BIRTH: 1/1/06 THRU 4/1/06

BIRTH DATE†† CHILD'S LAST†† MOTHER'S BIRTH†† MOTHER'S LAST†† ATTENDANT

----------------------------------------------------------------------------

2/20/06†††† ††††† PENALOZA†††† ††††† CAMBRIA†††††††† PENALOZA†††††† CALLAHAN,THADDEUS

SKIPPED (^S) ITEMS:††††††††††† 1B,

3/1/06†††††† VASQUEZ††††††† HERNANDEZ†††††† HERNANDEZ††††† MARSHALL,PEGGY

FILED (^F) AT:6A,

3/4/06†††††† JONES††††††††† SANCHEZ†††††††† JONES††††††††† SPENCER,TRUDY

SKIPPED (^S) ITEMS:††††††††††† 12B,13D,TYPE,23A,23B,

3/7/06†††††† ALEXANDER††††† AARON†††††††††† ALEXANDER††††† JURATSCH,CLYDE

FILED (^F) AT:MLN

 

 

HOSPITAL BIRTH RECORD OPTION >

 


AVSS Quick Reference Manual†††††††††† ††††††††††††††††††††††††††††††††††††††Hospital Birth Record, Newspaper Announcement Report

 

 

NEWSPAPER ANNOUNCEMENT REPORT

 

A report containing non-confidential information.This information is usually provided as a courtesy to newspapers by the hospital for birth announcements.

 

SYSTEM OPTION > [H] [Enter] OSPITAL BIRTH RECORD

 

HOSPITAL BIRTH RECORD OPTION > [NE] [Enter] WSPAPER ANNOUNCEMENT REPORT

 

DISPLAY MOTHER'S MAIDEN NAME <Y>[Enter]

ENTER BEGINNING VALUE FOR DATE OF BIRTH< 1/1/93 > [3/1/06] [Enter]

ENTER†††††† ENDING VALUE FOR DATE OF BIRTH< T > [3/7/06] [Enter]

 

 

BIRTHDATE†††† PARENT'S NAME†††††††††††††††††††††††††††††††††††††††††††† SEX

-----------------------------------------------------------------------------------

3/1/93††††††† DONATO VASQUEZ & LORRI CASTLE†††††††††††††††††††††††††††† GIRL

3/2/93††††††† MICHAEL VINING & MARSHA (WILLIAMS) VINING†††††† GIRL

3/4/93††††††† ROBERT JONES & MARIA (SANCHEZ) JONES††††††††††††† BOY

3/7/93††††††† COREY ALEXANDER & BEATRICE AARON††††††††††††††††††† GIRL

 

 

 

 

HOSPITAL BIRTH RECORD OPTION >

 


AVSS Quick Reference Manual††††††††††††††††††††††††††††††††††††††††††††††††††††††††††† Hospital Birth Record, HP Laserjet Form Alignment

 

 

HP LASERJET FORM ALIGNMENT

 

This option allows the user to make adjustments to the print positions on the birth certificate.If the print on the certificate needs to be moved left or right, up or down, or both, the user can do this.Adjustments made UP or DOWN can be done in increments .1 .2 .3 ... UP TO 1 then 2 3 4.Adjustments made LEFT or RIGHT can be in increments of whole spaces only (1 or 2).These adjustments are not for specific fields but for the entire birth certificate.

 

SYSTEM OPTION > [H] [Enter] OSPITAL BIRTH RECORD

 

HOSPITAL BIRTH RECORD OPTION > [HP] [Enter] LASER JET FORM ALIGNMENT

 

ENTER DEVICE <1> [Enter]

 

Note: If you see the message LASER JET PRINTER NOT SPECIFIED, your printer setup is not defined for a laser printer.See your System Manager or call the AVSS Help Desk.

 

ADJUST PRINT (U)P OR (D)OWN > [U] [Enter]

HOW MANY LINES (.1 .2 .3 ... UP TO 1 2 3 4) > [.7] [Enter]

ADJUST PRINT (L)EFT OR (R)RIGHT > [R] [Enter]

HOW MANY SPACES (1 2) [1] [Enter]

ADJUSTMENT SUCCESSFUL.

 

Note: If you see the message VERTICAL ADJUSTMENT OUT OF RANGE. or HORIZONTAL ADJUSTMENT OUT OF RANGE., you have requested an adjustment which is not possible.See your System Manager or call the AVSS Help Desk.

 


AVSS Quick Reference Manual†††††††††† †††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††Mailbox, Send Mail

 

 

MAILBOX

 

This option provides a way of communicating messages between AVSS users of the same computer system.If another user has sent you mail, AVSS will notify you when you sign-on.Your system manager can leave a message to all users on your system.This message will appear on every user's screen as soon as they sign-on.Messages may be printed to your screen or sent to a printer.The messages in your mailbox will remain on your system until you delete them.You will also be able to check a message that you have sent to another user to see if that user has read the message yet.

 

SEND MAIL

 

SYSTEM OPTION > [M][Enter]AILBOX OPTION

MAILBOX OPTION > [S][Enter]END MAIL

ADDRESSEE

NAME (LAST,FIRST) > [JONES][Enter]

ID# A/D††† LAST,FIRST,TITLE††††††††† ACKNOWLEDGE†††† CLASSIFICATION††††††† SITE

-------------------------------------------------------------------------------------------

8††† A††††† JONES,SANDRA,BIRTH CLERKSANDRA††††††††† HOSPITAL DATA ENTRY†† CNTY-19|HOSP-123

IS THIS THE PERSON <Y> [Enter]

ENTER MESSAGE:

 

EXAMPLE:

1 = DEPARTMENT MEETING AT 4:00PM TODAY. [Enter]

2 = PLEASE BRING YOUR NOTES ON THE TURNAROUND TIME PROJECT. [Enter]

3 = THANKS! [Enter]

 

 

MAIL FOR JONES,SANDRA,BIRTH CLERK

1>DEPARTMENT MEETING AT 4:00PM TODAY.

2>PLEASE BRING YOUR NOTES ON THE TURNAROUND TIME PROJECT.

3>THANKS!

 

 

OK? <Y>[Enter]

DESCRIPTION = [DEPT MEETING] [Enter]

SEND SAME MESSAGE TO ANOTHER USER <N> [Y] [Enter]

NEXT ADDRESSEE

NAME (LAST,FIRST) > [FIN,ROB] [Enter]

ID#A/D††† LAST,FIRST,TITLE†††††††† ACKNOWLEDGE†††† CLASSIFICATION††††††† SITE

-------------------------------------------------------------------------------------------

8††† A††††† FINCH,ROBIN,BIRTH CLERKROBIN†††††††††† HOSPITAL DATA ENTRY†† CNTY-19|HOSP-123

IS THIS THE PERSON <Y> [Enter]

 

 

MAIL FOR FINCH,ROBIN,BIRTH CLERK

1>DEPARTMENT MEETING AT 4:00PM TODAY.

2>PLEASE BRING YOUR NOTES ON THE TURNAROUND TIME PROJECT.

3>THANKS!

 

 

OK? <Y> [Enter]

 

DESCRIPTION = [DEPT MEETING] [Enter]

SEND SAME MESSAGE TO ANOTHER USER <N> [Enter]

SEND A DIFFERENT MESSAGE

ADDRESSEE

NAME (LAST,FIRST) > [Enter]

MAILBOX OPTION >

 


 

AVSS Quick Reference Manual†††††††††† †††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††Mailbox, Print Mail

 

 

PRINT MAIL

 

MESSAGES, MANAGER'S

Note:†† When you sign-on, MANAGER'S MESSAGES appear immediately.

 

GOOD MORNING ROBIN

TODAY IS THURSDAY 4/1/06 AT 9:22 AM

*** MANAGER'S MESSAGES:

WILSON,DENNIS,SITE SYSTEM MANAGER††††††††† 3/30/06†† 10:18†† AM

DESCRIPTION: BACKUP SCHEDULE

THE NEW BACKUP SCHEDULE FOR AVSS IS FRIDAYS AT 5:00PM.

PLEASE COMPLETE YOUR AVSS WORK BY THEN.THANK YOU.

 

 

SYSTEM OPTION > [M] [Enter] AILBOX OPTION

MAILBOX OPTION > [P] [Enter] RINT MAIL

PRINT MANAGER'S MESSAGES <N> [Y] [Enter]

PRINT MESSAGES > [^L]

1 WILSON,DENNIS,SITE SYSTEM MANAGER†† 3/30/06†† 10:18 AM

DESCRIPTION: BACKUP SCHEDULE

PRINT MESSAGES > [1]

OUTPUT DEVICE <T> [Enter]

Note: Enter a 'P' as the output device if you would like your mail to print on your printer.

 

1 WILSON,DENNIS,SITE SYSTEM MANAGER†† 3/30/0610:18 AM

DESCRIPTION: BACKUP SCHEDULE

THE NEW BACKUP SCHEDULE FOR AVSS IS FRIDAYS AT 5:00PM.

PLEASE COMPLETE YOUR AVSS WORK BY THEN.THANK YOU.

 

 

 

MESSAGES, USER'S

Note:†† When you log-on to AVSS, you will be notified if you have NEW or OLD mail.

 

GOOD MORNING ROBIN, YOU HAVE NEW MAIL

TODAY IS THURSDAY 4/1/06 AT 9:22 AM

 

 


AVSS Quick Reference Manual††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††† †††††††††††††††††††††††Mailbox, Print Mail (continued)

 

 

SYSTEM OPTION > [M] [Enter] AILBOX OPTION

 

MAILBOX OPTION > [P] [Enter] RINT MAIL

 

PRINT MESSAGES > [^L] [Enter]

1 SANDIEGO,CARMEN,HOSPITAL SYSTEM MANAGER†† 4/1/06†† 10:22AM

DESCRIPTION:DEPT MEETING

2 JONES,SANDRA,BIRTH CLERK†† 4/1/06†† 10:30AM

DESCRIPTION: HAPPY BIRTHDAY

 

PRINT MESSAGES > [1] [Enter]

 

OUTPUT DEVICE <T> [Enter]

Note: Enter a 'P' as the output device if you would like your mail to print on your printer.

 

 

1 SANDIEGO,CARMEN,HOSPITAL SYSTEM MANAGER4/1/0610:22AM***UNREAD***

DESCRIPTION: DEPT MEETING

DEPARTMENT MEETING AT 4:00PM TODAY.

PLEASE BRING YOUR NOTES ON THE TURNAROUND TIME PROJECT.

THANKS!

 

 

PRINT MESSAGES >

 


AVSS Quick Reference Manual†††††† ††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††Mailbox, Delete Mail

 

 

DELETE MAIL

 

MESSAGES, MANAGER'S

GOOD MORNING ROBIN

TODAY IS THURSDAY 4/1/93 AT 9:22 AM

 

 

*** MANAGER'S MESSAGES:

1 WILSON,DENNIS,SITE SYSTEM MANAGER†††††††††††† 3/30/06†††† 10:18 AM

DESCRIPTION:†† BACKUP SCHEDULE

THE NEW BACKUP SCHEDULE FOR AVSS IS FRIDAYS AT 5:00PM.

PLEASE COMPLETE YOUR AVSS WORK BY THEN.THANK YOU.

 

 

SYSTEM OPTION > [M] [Enter] AILBOX OPTION

 

MAILBOX OPTION > [D] [Enter] ELETE MAIL

 

DELETE MANAGER'S MESSAGES MESSAGES <N> [Y] [Enter]

 

DELETE MESSAGES >[^L][Enter]

 

1††† WILSON,DENNIS,SITE SYSTEM MANAGER††††††††† 3/30/93†††† 10:18 AM

DESCRIPTION:†† BACKUP SCHEDULE

 

DELETE MESSAGES >[1] [Enter]

1††† WILSON,DENNIS,SITE SYSTEM MANAGER††††††††† 3/30/93†††† 10:18 AM

DESCRIPTION:†† BACKUP SCHEDULE

OK TO DELETE <N> [Y] [Enter]

1 DELETED

 

DELETE MESSAGES > [Enter]

 

MAILBOX OPTION >


AVSS Quick Reference Manual†††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††† Mailbox, Delete Mail (continued)

 

 

MESSAGES, USER'S

SYSTEM OPTION > [M] [Enter] AILBOX OPTION

 

MAILBOX OPTION > [D] [Enter] ELETE MAIL

 

DELETE MESSAGES >[^L] [Enter]

1††† SANDIEGO,CARMEN,HOSPITAL SYSTEM MANAGER†††† 4/1/06†††† 10:22AM

DESCRIPTION:DEPT MEETING

2††† JONES,SANDRA,BIRTH CLERK†††† 4/1/06†††† 10:30AM

DESCRIPTION: HAPPY BIRTHDAY

DELETE MESSAGES > [2] [Enter]

 

2††† JONES,SANDRA,BIRTH CLERK†††† 4/1/06†††† 10:30AM

DESCRIPTION: HAPPY BIRTHDAY

OK TO DELETE <N> [Y] [Enter]

2 DELETED

DELETE MESSAGES > [1] [Enter]

1††† SANDIEGO,CARMEN,HOSPITAL SYSTEM MANAGER†††† 4/1/06†††† 10:22AM

DESCRIPTION:DEPT MEETING

OK TO DELETE <N> [Y] [Enter]

1 DELETED

ALL MESSAGES DELETED

 

MAILBOX OPTION >


AVSS Quick Reference Manual†††††††††† †††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††Mailbox, Report Status of Sent Mail

 

 

REPORT STATUS OF SENT MAIL

SYSTEM OPTION > [M] [Enter] AILBOX OPTION

 

MAILBOX OPTION > [R] [Enter] EPORT STATUS OF SENT MAIL

 

 

MAIL TO:†††††††† SANDIEGO,CARMEN

MESSAGE 2 SENT:†††† 4/1/06†††† 1:30PM†††† ***UNREAD***

COMMENT: RSVP TO DEPT MEETING

MAIL TO:†† JONES,SANDRA

MESSAGE 1 SENT:†††† 3/29/06†††† 10:45AM†††† READ:†††† 3/29/06††† 12:15PM

COMMENT:BIRTHDAY LUNCH

 

 

 

MAILBOX OPTION >

 


AVSS Quick Reference Manual†††††††††† †††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††Your Password, Change Your Password

 

 

CHANGE YOUR PASSWORD

 

In order to insure the security of your AVSS system, you will be alerted when you are required to change your password. Changing your password regularly prevents others from learning and using your password to gain access to AVSS.

If you forget your password you may call your local Health Department or the AVSS Help Desk at 916-449-5174 to reset your password.

 

SYSTEM OPTION > [Y] [Enter] OUR PASSWORD OPTION

 

ENTER CURRENT PASSWORD > [BAB1IES] [Enter]

Note: Enter the password that you are currently using.In other words, enter the same password that you used to get into AVSS.

 

ENTER DESIRED PASSWORD >†† [NURSERY11] [Enter]

Note: Enter your new password. This must be different from your current password.

AGAIN >††† [NURSERY11] [Enter]

 

Note: At the AGAIN prompt, you must enter the exact password that you put in at the ENTER DESIRED PASSWORD prompt.If it is not exactly the same, AVSS will not allow you to change your password.

PASSWORD HAS BEEN CHANGED!

 

CONTACT PHONE NUMBER <> [213-555-1212][Enter]

Note: Enter the phone number where you can normally be reached at work.

 

YOUR PASSWORD OPTION >

 


AVSS Quick Reference Manual†††††††††† ††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††Report Generator, Query Database

 

 

REPORT GENERATOR

 

The various Report Generator options allow hospital personnel to make use of the valuable demographic and medical data contained in the birth certificate.Ad hoc queries and standard reports including formatted form letters, listings, cross-tabulations, and summary reports are available.

 

QUERY DATABASE

 

Querying a database may be used to search the database using one or more fields from the birth certificate.The resulting report will display the records that matched the criteria you requested.Included below are several examples of various "queries" which you can try.

 

EXAMPLE #1 - SEX OF CHILD:

SYSTEM OPTION > [R] [Enter] EPORT GENERATOR

 

REPORT GENERATOR OPTION > [Q] [Enter] UERY DATABASE

INITIALIZING...

 

FORM. SELECTION > [HCA] [Enter]= HOSPITAL BIRTH RECORD

 

FORM. SELECTION > [LCA] [Enter]= BIRTH CERTIFICATE

 

FORM. SELECTION > [Enter]

 

XIND. SITE CODES > [123] [Enter]

..

 

XIND. SITE CODES > [19] [Enter]

..

 

XIND. SITE CODES > [Enter]

 

THE FOLLOWING SITES / FORMS WILL BE REPORTED ON:

†††† 19†† LCA

†††† 123HCA

 

Note:†† Enter the three digit code for your hospital.It is located on the bottom, left-hand side in box A of a completed birth certificate.

XIND. SITE CODES > [Enter]

 

THE FOLLOWING SITES / FORMS WILL BE REPORTED ON:

†††† 19†† LCA

†††† 123HCA

 

Note:†† Enter the birth certificate field number that you want to ask about or if you're unsure, you can get a complete list of fields to choose from typing^L or using the F3 key.

 

LEVEL 1: FIELD TO BE REPORTED ON > [2] [Enter] (SEX OF CHILD)

LEVEL 1: PLEASE ENTER SPECIFIC VALUE (S) > [Enter]

 

INDEX TO SEARCH <DATE OF BIRTH> [Enter]

 

ENTER BEGINNING VALUE FOR DATE OF BIRTH <1/1/06> [2/1/06] [Enter] (2/1/06)

ENTER†††††† ENDING VALUE FOR DATE OF BIRTH <T> [Enter] (4/1/06)

 

DO YOU WANT TO FILE VARIABLE VALUES ON ALL RECORDS FOUND DURING THE QUERY <N> [Enter]

Note:†† Enter a "Y" here if you wish to see the record number for each match in your query.


SAVE THESE COMMANDS FOR THE REPORT GENERATOR <N>[Enter]

 

RUN THIS REPORT IN THE BACKGROUND <N>[Enter]

 

Note: You can run this query in the background, if you wish.

(See REPORT GENERATOR, GENERATE REPORT RUNNING A REPORT IN THE BACKGROUND.)

 

SAVE THE OUTPUT FROM THIS REPORT <N> [Enter]

 

OUTPUT DEVICE <T> [Enter]

Note: Enter a P as the output device if you would like your listing to print on your

Printer.

 

 

SEARCHING DATABASE XXXXXXX

9 CERTIFICATES ARE REGISTERED

THE NUMBER OF CERTIFICATES REPORTED ON IS 9 (100.00%)

DO YOU WISH TO GROUP,SEE DISTINCT VALUES,CONTINUE OR QUIT (G/V/C/Q) [V][Enter]

 

OUTPUT DEVICE <T>†† [Enter]

Note:†† Enter a P as the output device if you would like your listing to print on your

Printer.

 

SEX OF CHILD:

FEMALE ... 5... 55.56%

MALE ... 4 ... 44.44%

 

 

DO YOU WISH TO GROUP, SEE DISTINCT VALUES, CONTINUE OR QUIT (G/V/C/Q) [Q] [Enter]

 

REPORT GENERATOR OPTION >

 

Note: If you want the file numbers of all mothers who were 15 years old or younger and had a baby during the year of 2005:

 

EXAMPLE #2 - MOTHER'S AGE:

REPORT GENERATOR OPTION > [Q] [Enter] UERY DATABASE

INITIALIZING........

 

FORM. SELECTION > [HCA] [Enter]= HOSPITAL BIRTH RECORD

 

FORM. SELECTION > [LCA] [Enter]= BIRTH CERTIFICATE

 

FORM. SELECTION > [Enter]

 

XIND. SITE CODES > [123] [Enter]

..

 

XIND. SITE CODES > [19] [Enter]

..

 

XIND. SITE CODES > [Enter]

 

THE FOLLOWING SITES / FORMS WILL BE REPORTED ON:

†††† 19†† LCA

†††† 123HCA

 

Note:†† Enter the three digit code for your hospital.It is located on the bottom, left-hand side in box A of a completed birth certificate.

XIND. SITE CODES > [Enter]

 


AVSS Quick Reference Manual†††††††††† ††††††††††††††††††††††††††††††††††††††††††††††††††††††††Report Generator, Query Database (continued)

 

 

THE FOLLOWING SITES / FORMS WILL BE REPORTED ON:

†††† 19†† LCA

†††† 123HCA

 

LEVEL 1: FIELD TO BE REPORTED ON > [MAGE] [Enter]

LEVEL 1: PLEASE ENTER SPECIFIC VALUE (S) > [1--15] [Enter]

 

LEVEL 2: FIELD TO BE REPORTED ON > [Enter]

INDEX TO SEARCH <DATE OF BIRTH> [Enter]

 

ENTER BEGINNING VALUE FOR DATE OF BIRTH <1/1/06> [1/1/05] [Enter] (1/1/05)

ENTER†††††† ENDING VALUE FOR DATE OF BIRTH <T> [12/31/05] [Enter] (12/31/05)

 

DO YOU WANT FILE VARIABLE VALUES ON ALL RECORDS FOUND DURING THE QUERY <N> [Y] [Enter]

Note:†† Enter a "Y" here if you wish to see the record number for each match in your query.

 

SAVE THESE COMMANDS FOR THE REPORT GENERATOR <N> [Enter]

 

RUN THIS REPORT IN THE BACKGROUND <N> [Enter]

 

SAVE THE OUTPUT FROM THIS REPORT <N> [Y] [Enter]

 

SOC.SAVE OUTPUT CODE >[MAGE05] [Enter]

 

ENTER A DESCRIPTION FOR THIS REPORT > [2005 MOTHERS UNDER 15] [Enter]

Note:†† Saving the output from this report allows you to print the listing now and/or print this listing later (see REPORT GENERATOR, OUTPUT SAVED REPORT).

 

OUTPUT DEVICE <T> [Enter]

Note: Enter a 'P' as the output device if you would like your listing to print on your

Printer.

 

SEARCHING DATABASE XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

117 CERTIFICATES ARE REGISTERED

113 CERTIFICATES OF THOSE HAD OTHER THAN THE SPECIFIED VALUE(S) LEAVING 4

THE NUMBER OF CERTIFICATES REPORTED ON IS 4 (3.42%)

 

 

DO YOU WISH TO GROUP, SEE DISTINCT VALUES, CONTINUE, OR QUIT (G/V/C/Q) [V] [Enter]

OUTPUT DEVICE <T>[Enter]

Note: Enter a 'P' as the output device if you would like your listing to print on your

Printer.

 

MOTHER'S AGE AT CHILD'S BIRTH:1--15...4 SUCCESSES, 113 FAILURES (3.42%)

15:3515†††††††† :123... 1 ...25%†† FILE# 3515†††††††††† (123:HCA)

14:3690†††††††† :123... 1 ...25%†† FILE# 3690†††††††††† (123:HCA)

15:8684†††††††† :123... 1 ...25%†† FILE# 8684†††††††††† (123:HCA)

14:1200619000125:19†††† 1††† 25%†† FILE# 1200619000125(19:LCA)

 

 

Note: The report shows that during 2005, there were 116 birth certificates entered into the computer.Of those 116 certificates, 113 did not match but 3 did match your query.When you asked to see the distinct values AVSS gave you the 3 matched values that are displayed above in the following format:

Mother's age:File#:Site code.How many.Percentage of total FILE# File# (Site code:Form)

 

DO YOU WISH TO GROUP, SEE DISTINCT VALUES, CONTINUE, OR QUIT (G/V/C/Q)[Q][Enter]

 

REPORT GENERATOR OPTION >


AVSS Quick Reference Manual††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††† Report Generator, Query Database (continued)

 

 

Note: After running the AVSS standard report #HANOMT for the year 1992 (see REPORT GENERATOR, GENERATE REPORT-††††† RUNNING REPORT IN THE FOREGROUND), the report output includes the following:

EXAMPLE #3 - SEARCH FOR COMPLICATION:

 

 

CONGENITAL ANOMALIES FOR FORM:††† HCA

BY HOSPITAL AT: TEST HOSPITAL††††††††††††††††† REPORT CODE: #HANOMT

DATE RANGE:†††† 1/1/05 TO 12/31/05†††††††††††††††† TODAY: 4/1/06

45=PREAXIAL POLYDACTYLY(PART OF 755.0)†††††† 0††††††† 0.00%

46=OTHER POLYDACTYLY(REMAINDER OF 755.0)†††† 0††††††† 0.00%

47=SYNDACTYLY OF FINGERS/TOES(755.1)†††††††† 0††††††† 0.00%

48=MISSING FINGERS/TOES(755.2/3)†††††††††††† 0††††††† 0.00%

49=OTHER MISSING EXTREMITY(755.2-755.4)††††† 1††††††† 0.86%

50=CRANIOSYNOSTOSIS(PART OF 756.0)†††††††††† 0††††††† 0.00%

etc...

TOTAL NUMBER OF BIRTHS†††† 116

 

 

Note: You then wanted to query the database to get the file number for the one birth certificate that listed complication 49 in field 31.Continue as follows:

REPORT GENERATOR OPTION > [Q] [Enter] UERY DATABASE

INITIALIZING........

 

FORM. SELECTION > [HCA] [Enter] = HOSPITAL BIRTH RECORD

FORM. SELECTION > [Enter]

 

XIND. SITE CODES > [123] [Enter]

XIND. SITE CODES > [Enter]

 

THE FOLLOWING SITES / FORMS WILL BE REPORTED ON:

123 †††† HCA

 

LEVEL 1: FIELD TO BE REPORTED ON > [31] [Enter]ABNORMAL CONDITIONS AND CLINICAL PROCEDURES...

LEVEL 1: PLEASE ENTER SPECIFIC VALUES(S) > [*49] [Enter]

 

Note: Be sure to type the asterisk (*) in front of the specific value.In this example, AVSS will look for any birth certificate that includes the code 49 in field 31.

LEVEL 2: FIELD TO BE REPORTED ON >[Enter]

 

INDEX TO SEARCH <DATE OF BIRTH> [Enter]

 

ENTER BEGINNING VALUE FOR DATE OF BIRTH <1/1/06> [1/1/05] [Enter] (1/1/05)

ENTER ENDING VALUE FOR DATE OF BIRTH <T> [12/31/05] [Enter] (12/31/05)

 

DO YOU WANT FILE VARIABLE VALUES ON ALL RECORDS FOUND DURING THE QUERY <N> [Y] [Enter]

 

SAVE THESE COMMANDS FOR THE REPORT GENERATOR <N> [Enter]

 

RUN THIS REPORT IN THE BACKGROUND <N> [Enter]

 

SAVE THE OUTPUT FROM THIS REPORT<N> [Enter]

 

OUTPUT DEVICE <T> [Enter]

Note:Enter a 'P' as the output device if you would like your listing to print on your

printer.

 


AVSS Quick Reference Manual†††††††††† ††††††††††††††††††††††††††††††††††††††††††††††††††††††††Report Generator, Query Database (continued)

 

 

SEARCHING DATABASE XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

116 CERTIFICATES ARE REGISTERED

115 CERTIFICATES OF THOSE HAD OTHER THAN THE SPECIFIED VALUE(S) LEAVING 1

THE NUMBER OF CERTIFICATES REPORTED ON IS 1 (0.86%)

 

 

DO YOU WISH TO GROUP, SEE DISTINCT VALUES, CONTINUE, OR QUIT (G/V/C/Q) [V][Enter]

 

OUTPUT DEVICE <T>[Enter]

Note:†† Enter a 'P' as the output device if you would like your listing to print on your

printer.

 

ABNORMAL CONDITIONS AND CLINICAL PROCEDURES RELATING TO THE NEWBORN: *49...1 SUCCESSES

115 FAILURES (0.86%)

49,71:3301:123... 1 ...100.00%†† FILE#†† 3301†† (123:HCA)

 

 

Note:†† The query found and displayed the occurrence of the codes 49 and 71, which was also in field 31 for this baby.

 

DO YOU WISH TO GROUP, SEE DISTINCT VALUES, CONTINUE, OR QUIT (G/V/C/Q) [Q] [Enter]

 

REPORT GENERATOR OPTION >


AVSS Quick Reference Manual††† †††††††††††††††††††Report Generator, Generate Report-Running A Report In The Foreground

 

GENERATE REPORT - RUNNING A REPORT IN THE FOREGROUND

 

A report run in the "Foreground" (rather than the "Background") means that the report will tie up your terminal while it is running.You won't be able to use your terminal until the report finishes.Since most reports take only a few minutes to run, this is usually the easiest way to run reports.

 

SYSTEM OPTION > [R] [Enter] EPORT GENERATOR

REPORT GENERATOR OPTION > [G] [Enter] ENERATE REPORT

REP. REPORT > [#H] [Enter]

 

 

1††† #HAGE1X=TEENAGE CROSS TABS BY HOSPITAL

2††† #HAGE2X=MATERNAL AGE CROSS TABS BY HOSPITAL

3††† #HANOMT=CONGENITAL ANOMALIES BY HOSPITAL

4††† #HBW1X=BIRTH WEIGHT CROSS TABS BY HOSPITAL

5††† #HDLVY1X=METHOD OF DELIVERY CROSS TABS BY HOSPITAL

6††† #HED1X=MATERNAL EDUCATION CROSS TABS BY HOSPITAL

7††† #HETH1X=ETHNICITY CROSS TABS BY HOSPITAL

8††† #HGABWX=GESTATIONAL AGE BY BIRTHWEIGHT BY HOSPITAL

9††† #HHISPT=HISPANIC SPECIFICATIONS BY HOSPITAL

10#HLATR1T=LATE REGISTRATION

11#HLDCT=LABOR AND DELIVERY COMPLICATIONS/PROCEDURES BY HOSPITAL

. . . etc...

 

 

HIT RETURN TO CONTINUE, Q OR ^Q TO QUIT, OR SELECTION #

> [3] [Enter] #HANOMT = CONGENITAL ANOMALIES BY HOSPITAL

 

ENTER BEGINNING VALUE FOR DATE OF BIRTH <1/1/06> [1/1/05] [Enter] (1/1/05)

ENTER ††† †††ENDING VALUE FOR DATE OF BIRTH <T> [12/31/05] [Enter] (12/31/05)

 

RUN THIS REPORT IN THE BACKGROUND <N> [Enter]

 

SAVE THE OUTPUT FROM THIS REPORT <N> [Y] [Enter]

SOC.SAVE OUTPUT CODE >[HANOMT05][Enter]

Note: The output code name must be 8 or less, alphanumeric characters.

ENTER A DESCRIPTION FOR THIS REPORT > [2005 CONGENITAL ANOMALIES REPORT] [Enter]

 

Note: Saving the output from this report allows you to print the listing now and/or print this listing later(see REPORT GENERATOR, OUTPUT SAVED REPORT).

 

OUTPUT DEVICE <T>[Enter]

Note:†† Enter a 'P' as the output device if you would like your listing to print on your

printer.

PREPARING REPORT...............................................................................................

EXECUTING REPORT....

 

CONGENITAL ANOMALIES FOR FORM: HCA

BY HOSPITAL AT: TEST HOSPITAL††††††††††††††††††††††††††††††††† REPORT CODE: #HANOMT

DATE RANGE: 1/1/05 TO 12/31/05††††††††††††††††††††††††††††††††††††† TODAY: 4/1/06

01=ANENCEPHALUS (740.0,740.1,740.2)††††††††††††††††††††††††††††††††††††††††††††††††††††††††††† 0†††††††††††††††† 0.00%

02=SPINA BIFIDA (741.0,741.9)††††† †††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††0†††††††††††††††† 0.00%

03=ENCEPHALOCELE (742.0)††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††† 0†††††††††††††††† 0.00%

04=MICROCEPHALUS (742.1)†††††† †††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††0†††††††††††††††† 0.00%

05=HYDROCEPHALUS (741.0,742.3)††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††† 0†††††††††††††††† 0.00%

06=OTHER CENTRAL NERVOUS SYSTEM ANOMALIES (740-742)†††††††††††††† 0†††††††††††††††† 0.00%

etc...

TOTAL NUMBER OF BIRTHS†††††††††††††† 116

START:†††† 4/1/06†††† 01:22PM†††††††††††††† END: 4/1/06†††† 01:27PM

REPORT GENERATOR OPTION >


AVSS Quick Reference Manual††††††††††††††††††††† Report Generator, Generate Report-Running A Report In The Background

 

GENERATE REPORT - RUNNING A REPORT IN THE BACKGROUND

 

A report run in the "Background" (rather than the "Foreground") means that the report will not tie up your terminal while it is running.You will be able to use your terminal for other AVSS functions.This method is advisable when you feel the report you are about to run may take longer than a few minutes.The length of time will depend on the speed of your computer, the number of births at your hospital, and the time period you are covering.

 

 

SYSTEM OPTION > [R] [Enter] EPORT GENERATOR

 

REPORT GENERATOR OPTION > [G] [Enter] ENERATE REPORT

 

REP. REPORT > [#H] [Enter]

 

 

1 #HAGE1X=TEENAGE CROSS TABS BY HOSPITAL

2 #HAGE2X=MATERNAL AGE CROSS TABS BY HOSPITAL

3 #HANOMT=CONGENITAL ANOMALIES BY HOSPITAL

4 #HBW1X=BIRTH WEIGHT CROSS TABS BY HOSPITAL

5 #HDLVY1X=METHOD OF DELIVERY CROSS TABS BY HOSPITAL

6 #HED1X=MATERNAL EDUCATION CROSS TABS BY HOSPITAL

7 #HETH1X=ETHNICITY CROSS TABS BY HOSPITAL

8 #HGABWX=GESTATIONAL AGE BY BIRTHWEIGHT BY HOSPITAL

9 #HHISPT=HISPANIC SPECIFICATIONS BY HOSPITAL

10 #HLATR1T=LATE REGISTRATION

11 #HLDCT=LABOR AND DELIVERY COMPLICATIONS/PROCEDURES BY HOSPITAL

etc...

 

 

HIT RETURN TO CONTINUE, Q OR ^Q TO QUIT, OR SELECTION #

> [11] [Enter] #HLDCT = LABOR AND DELIVERY COMPLICATIONS/PROCEDURES BY HOSPITAL

 

ENTER BEGINNING VALUE FOR DATE OF BIRTH <1/1/06> [5/1/06] [Enter](5/1/06)

ENTER†† ENDING VALUE FOR DATE OF BIRTH <T> [5/31/06] [Enter](5/31/06)

 

RUN THIS REPORT IN THE BACKGROUND <N> [Y] [Enter]

 

SOC. SAVE OUTPUT CODE >[LDCMP506] [Enter]

Note:†† The output code name must be 8 or less, alphanumeric characters.

ENTER A DESCRIPTION FOR THIS REPORT > [MAY 2006 L&D COMPLICATIONS] [Enter]

 

Note: Saving the output from this report allows you to print the listing later (see REPORT GENERATOR, OUTPUT SAVED REPORT).

 

DELAY UNTIL <NOW> [Enter]

THIS REPORT BEING RUN IN THE BACKGROUND.

EXIT


AVSS Quick Reference Manual†††††††††† †††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††Report Generator, Output Saved Report

 

 

OUTPUT SAVED REPORT

 

Reports that have been run in the background may be retrieved by using this option.The report may be sent to the terminal, printer, or to a file on the AVSS Server.The reports may be printed many times until they are deleted.

 

EXAMPLE #1 - OUTPUT THE DATA FROM THE QUERY SAVED AS 'MAGE05':

SYSTEM OPTION > [R] [Enter] EPORT GENERATOR

 

REPORT GENERATOR OPTION > [O] [Enter] UTPUT SAVED REPORT

 

ID.†† ID CODE # <13> [Enter] FINCH,ROBIN,BIRTH CLERK

OUT.†† OUTPUT REPORT CODE > [^L] [Enter]

 

Note: Type the first few characters of the code name of the report, or you can get a complete listing of all reports typing ^L or using the F3 key.

HANOMT05=2005 CONGENITAL ANOMALIES REPORT (4/1/0601:22 PM)

LDCMP592=MAY 2006 L&D COMPLICATIONS†††† (6/14/06 11:55 AM)

MAGE05=2005 MOTHERS UNDER 15-CONGENITAL ANOMALIES (2/21/06 05:11 PM)

OUT.†† OUTPUT REPORT CODE > [MAGE05] [Enter] 2005 MOTHERS UNDER 15-CONGENITAL ANOMALIES

MAGE05 = 2005 MOTHERS UNDER 15-CONGENITAL ANOMALIES†††† (2/21/06††† 05:11 PM)

MAGE05 = [Enter]

Note:†† The above report description may be changed using AVSS Edit Commands. (See BACK COVER)

OUTPUT DEVICE <T> [P][Enter]

Note: Enter a 'T' as the output device if you would like your listing on your terminal.

 

Example:

 

 

116 CERTIFICATES ARE REGISTERED

113 CERTIFICATES OF THOSE HAD OTHER THAN THE SPECIFIED VALUE(S) LEAVING 3

THE NUMBER OF CERTIFICATES REPORTED ON IS 3 (2.59%)

 

MOTHER'S AGE AT CHILD'S BIRTH:1 -- 15 . . .3 SUCCESSES†† 113 FAILURES (2.59%)

 

15:3515:123. . .†† 1 . . . 33,33%†††† FILE# 3515†††††††† (123:HCA)

14:3690:123. . .†† 1 . . . 33.33%†††† FILE# 3690†††††††† (123:HCA)

15:8684:123. . .†† 1 . . . 33.33%†††† FILE# 8684†††††††† (123:HCA)

 

 

REPORT GENERATOR OPTION >


AVSS Quick Reference Manual†††††††††††††††††††††††††††††††††††††††††††††††††††††††††† Report Generator, Output Saved Report (continued)

 

 

EXAMPLE #2 - OUTPUT THE DATA FROM THE STANDARD REPORT #HLDCT SAVED AS 'LDCMP506':

SYSTEM OPTION > [R] [Enter] EPORT GENERATOR

 

REPORT GENERATOR OPTION > [O] [Enter] UTPUT SAVED REPORT

 

ID.†† ID CODE # <13>††††† [Enter]††††† FINCH,ROBIN,BIRTH CLERK

 

OUT.†† OUTPUT REPORT CODE > [^L][Enter]

Note:†† Type the first few characters of the code name of the report, or you can get a complete listing of all reports typing ^L or using the F3 key.

 

HANOMT05=2005 CONGENITAL ANOMALIES REPORT (4/1/06 01:22 PM)

LDCMP506=MAY 2006 L&D COMPLICATIONS†††† (6/14/06 11:55 AM)

MAGE05=2005 MOTHERS UNDER 15-CONGENITAL ANOMALIES (2/21/06††† 05:11 PM)

 

OUT.†† OUTPUT REPORT CODE > [LDCMP506][Enter] MAY 2006 L&D COMPLICATIONS

LDCMP506 =MAY 2006 L&D COMPLICATIONS

 

LDCMP506 = [Enter]

Note: The above report description may be changed using AVSS Edit Commands. (See BACK COVER)

 

OUTPUT DEVICE <T> [P] [Enter]

Note: Enter a 'T' as the output device if you would like your listing on your terminal.

 

 

LABOR AND DELIVERY COMPLICATIONS/PROCEDURES FOR FORM:†††††††††† HCA

BY HOSPITAL AT:††††† TEST HOSPITAL††††††††††††††††††††††††††††††††††††††††††††††††††††††††† REPORT CODE:#HLDCT

DATE RANGE:†††† 5/1/06TO5/31/06†††††††††††††††††††††††††††††††††††††††††††††††††††††††††††† TODAY:6/30/06

 

LABOR AND DELIVERY COMPLICATION/PROCEDURE CODES:

 

01=PRE-ECLAMPSIA†††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††† 0††††††††††††††††††††††††††††††††††† 0.00%

02=ECLAMPSIA†††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††† 0††††††††††††††††††††††††††††††††††† 0.00%

03=SEIZURES DURING LABOR††††††††††††††††††††††††††††††††††††††††††††††††††††††† 0††††††††††††††††††††††††††††††††††† 0.00%

04=FETOPELVIC DISPROPORTION††††††††††††††††††††††††††††††††††††††††††††††† 0††††††††††††††††††††††††††††††††††† 0.00%

05=SHOULDER DYSTOCIA††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††† 0††††††††††††††††††††††††††††††††††† 0.00%

06=BREECH/ABNORMAL PRESN††††††††††††††††††††††††††††††††††††††††††††††††††† 7††††††††††††††††††††††††††††††††††† 11.67%

07=PRECIPITOUS LABOR(<3HRS)††††††††††††††††††††††††††††††††††††††††††††††† 1††††††††††††††††††††††††††††††††††† 1.67%

08=PROLONGED LABOR(<20HRS)†††††††††††††††††††††††††††††††††††††††††††††† 1††††††††††††††††††††††††††††††††††† 1.67%

09=OTHER DYSFUNCTIONAL LABOR††††††††††††††††††††††††††††††††††††††††††† 2††††††††††††††††††††††††††††††††††† 3.33%

10=PREM RUPT MEMBRNES(>12HRS)††††††††††††††††††††††††††††††††††††††† 2††††††††††††††††††††††††††††††††††† 3.33%

11=INDUCTION OF LABOR††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††† 10†††††††††††††††††††††††††††††††† 16.67%

12=STIMULATION OF LABOR††††††††††††††††††††††††††††††††††††††††††††††††††††††††††† 21†††††††††††††††††††††††††††††††† 35.00%

13=ABRUPTIO PLACENTA†††††††††††††††††††††††††††††††††††††††††††††††††††††††††† ††††† 1††††††††††††††††††††††††††††††††††† 1.67%

14=PLACENTA PREVIA†††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††† 0††††††††††††††††††††††††††††††††††† 0.00%

15=OTHER EXCESSIVE BLEEDING†††††††††††††††††††††††††††††††††††††††††††††††† 0††††††††††††††††††††††††††††††††††† 0.00%

16=GENITAL HERPES†††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††† 0††††††††††††††††††††††††††††††††††† 0.00%

17=AMNIONITIS/SEPSIS†††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††† 0††††††††††††††††††††††††††††††††††† 0.00%

18=FEBRILE (>100F OR >38C)†††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††† 0††††††††††††††††††††††††††††††††††† 0.00%

19=MECONIUM(MODERATE/HEAVY)†††††††††††††††††††††††††††††††††††††† 1††††††††††††††††††††††††††††††††††† 1.67%

20=CORD PROLAPSE†††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††† 0††††††††††††††††††††††††††††††††††† 0.00%

21=FETAL DISTRESS††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††† 5††††††††††††††††††††††††††††††††††† 8.33%

22=ANESTHETIC COMPLICATIONS/PROCEDURES†††††††††††††††††† 0††††††††††††††††††††††††††††††††††† 0.00%

23=UNSUCCESSFUL VBAC††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††† 0††††††††††††††††††††††††††††††††††† 0.00%

24=MATERNAL BLOOD TRANSFUSION††††††††††††††††††††††††††††††††††††††††† 0†††††††††††††††† †††††††††††††††††† 0.00%

25=MATERNAL TRNSPRT BEF DLVRY†††††††††††††††††††††††††††††††††††††††††† 0††††††††††††††††††††††††††††††††††† 0.00%

26=AMNIOCENTESIS†††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††† 0††††††††††††††††††††††††††††††††††† 0.00%

27=ELECTRONIC FETAL MONITORING††††††††††††††††††††††††††††††††††††††††† 59†††††††††††††††††††††††††††††††† 98.33%

28=TOCOLYSIS†††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††† 0††††††††††††††††††††††††††††††††††† 0.00%

29=ULTRASOUND†††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††† 5††††††††††††††††††††††††††††††††††† 8.33%

30=MATERNAL DEATH†††††††††††††††††††††††††††††††††††††††††††††††††††††††††† †††††††††††† 1††††††††††††††††††††††††††††††††††† 1.67%

31=OTHER†††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††† 3††††††††††††††††††††††††††††††††††† 5.00%

 

SINGLE COMPLICATION/PROCEDURE BIRTHS††††††††††††††††††††††††† 19†††††††††††††††††††††††††††††††† 31.67%

MULTIPLE COMPLICATION/PROCEDURE BIRTHS†††††††††††††††††††† 40†††††††††††††††††††††††††††††††† 66.67%

BIRTHS WITH COMPLICATIONS/PROCEDURES†††††††††††††††††††††††† 59†††††††††††††††††††††††††††††††† 98.33%

NO COMPLICATIONS/PROCEDURES†††††††††††††††††††††††††††††††††††††††††††† 1††††††††††††††††††††††††††††††††††† 1.67%

UNKNOWN†††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††† 0††††††††††††††††††††††††††††††††††† 0.00%

----------------------------------------------------------------------------------------------------------------------------------------------------

TOTAL NUMBER OF BIRTHS†††††††††††††††††††††††††††††††††††††††††††††††††††††††††††† 60

 

START:†††† 6/14/06††††††††† 11:55AM††††††††††††††††††† END:6/14/06††††††††† 11:55AM

 

REPORT GENERATOR OPTION >

 


AVSS Quick Reference Manual†††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††† Report Generator, List Saved Reports

 

 

LIST SAVED REPORTS

 

The reports that you have run in the background will remain in AVSS so that you can print them later at any time.

 

SYSTEM OPTION > [R] [Enter] EPORT GENERATOR

 

REPORT GENERATOR OPTION > [L] [Enter] IST SAVED REPORTS

 

DISPLAY/PRINT REPORT OUTPUT LISTINGS

 

OUTPUT DEVICE <T> [T] [Enter]

Note:†† Enter a 'P' as the output device if you would like your listing on your printer.

 

 

FINCH,ROBIN,BIRTH CLERK††† (ID=13)

ID†††† DATE†††††† SIZE††† NAME†††††† DESCRIPTION

-----------------------------------------------------------------------------------

13†††† 4/1/06†††† 100†††† MAGE05†††† 2005 MOTHERS UNDER 15(4/1/06 01:22 PM)

13†††† 6/14/06†† 100†††† HANOMT05†† 2005 CONGENITAL ANOMALIES REPORT(6/14/06 1:55 AM)

13††† 7/2/06†††† 100†††† LDCMP506†† MAY 2006 L&D COMPLICATIONS(7/2/06 02:35 PM)

 

 


AVSS Quick Reference Manual†††††††††† ††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††Report Generator, Delete Saved Report

 

 

DELETE SAVED REPORT

 

The reports that you have run in the background and have reviewed and printed will need to be deleted periodically so that valuable disk space is not wasted.

 

SYSTEM OPTION > [R] [Enter] EPORT GENERATOR

 

REPORT GENERATOR OPTION > [D] [Enter] ELETE SAVED REPORTS

 

FINCH,ROBIN,BIRTH CLERK†††† (ID=13)

 

ID†††† DATE††††† SIZE†††† NAME†††† DESCRIPTION

------------------------------------------------------------------------------------

13†††† 4/1/05††† 100††††† HANOMT05 2005 CONGENITAL ANOMALIES REPORT(4/1/06 01:22 PM)

DELETE <N> [Enter]

13†††† 6/14/06†† 237††††† LDCMP506 MAY 2006 L&D COMPLICATIONS(6/14/06 11:55 AM)

DELETE <N> [Y] [Enter] DELETED.

 

REPORT GENERATOR OPTION >


AVSS Quick Reference Manual††††††††††††††††††††††††††††††††††††††††††††† †††††††††††††††††††††††††††††††††††††††††††††††††††††System Maintenance, ID File

 

 

ID FILE

 

Please contact your local Health Department or the AVSS Help Desk to perform these functions for you.Each user ID must first be admitted to AVSS.Any individual may then be deactivated, reactivated, or edited as needed.Listings of all users, active and inactive or a list of when each user last logged onto AVSS may be printed for you upon your request.

 

ADD A USER

SYSTEM OPTION > [S] [Enter] YSTEM MAINTENANCE OPTION

SYSTEM MAINTENANCE OPTION > [ID] [Enter] FILE

ID FILE FUNCTION > [^L] [Enter]

ENTER†† 'A' TO ADMIT A PERSON,

††††††† 'E' TO EDIT A PERSON,

††††††† 'D' TO DEACTIVATE A PERSON

††††††† 'R' TO REACTIVATE A PERSON

††††††† 'L' TO LIST ID FILE ENTRIES,

††††† ††'U' FOR USER LIST BY LAST LOGIN.

ID FILE FUNCTION > [A][Enter]

NAME (LAST,FIRST MIDDLE,TITLE) > [FINCH,ROBIN,BIRTH CLERK] [Enter]

PERSON NOT FOUND

NAME (LAST,FIRST MIDDLE,TITLE) > [FINCH,ROBIN,BIRTH CLERK] [Enter]

 

Note: AVSS is confirming for you that there is no other user being admitted by that name.If there had been a †††††††††††††††† user with the same or similar name, that user would have been displayed and you would choose to continue or not.

 

CLASSIFICATION > [^L] [Enter]

1:††††††††††††††† SYSTEM MANAGER

100††††† :†††† SITE SYSTEM MANAGER

200††††† :†††† COUNTY SYSTEM MANAGER

300††††† :†††† HOSPITAL SYSTEM MANAGER

400††††† :†††† REMOTE HOSPITAL MANAGER

500††††† :†††† COUNTY DATA ENTRY

600††††† :†††† HOSPITAL DATA ENTRY

700††††† :†††† REMOTE HOSPITAL DATA ENTRY

800††††† :†††† ANALYST

900††††† :†††† RESERVED FOR FUTURE USE

CLASSIFICATION > [600][Enter]

 

Note:†† See the CLASSIFICATION/SECURITY OPTION TABLES for a breakdown of the access provided each classification.

 

LOG-IN PASSWORD > [BABY] [Enter]

ACKNOWLEDGEMENT NAME > [ROBIN] [Enter]

Note: The acknowledgement name is the name that AVSS greets you with when you first sign-on.


AVSS Quick Reference Manual††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††† System Maintenance, ID File (continued)

 

 

CONTACT PHONE NUMBER > [213-555-2222] [Enter]

Note: Enter the phone number where you can normally be reached at work.

ALL COUNTYS <N> [Enter]

CNTY. COUNTY > [19] [Enter] = LOS ANGELES

ALL HOSPITALS <N> [Enter]

HOSP. HOSPITAL > [123] [Enter] AVSS TEST HOSPITAL (123)

DISPLAY HELP > [Enter]

DISPLAY LISTS > [Enter]

 

Note: Displaying HELP and LISTS can be beneficial as a training aid.If you choose YES to these options, all help text and lists within AVSS will be displayed at appropriate prompts without using F1 for HELP or F3 for LISTS.

LAST,FIRST MIDDLE,TITLE >FINCH,ROBIN,BIRTH CLERK

CLASSIFICATION > 600

PASSWORD > BABY

ACKNOWLEDGEMENT NAME > ROBIN

PHONE > 213-555-2222

INDEX > CNTY-19|HOSP-123

DISPLAY HELP >

DISPLAY LISTS >

OK? (Y/N) > [Y][Enter]

SETTING UP ID FILE ENTRY ...

ID FILE FUNCTION >

 

EDIT A USER

SYSTEM OPTION > [S] [Enter] YSTEM MAINTENANCE OPTION

SYSTEM MAINTENANCE OPTION > [ID] [Enter] FILE

ID FILE FUNCTION > [E] [Enter] DIT

NAME (LAST,FIRST) > [BEREN] [Enter]

ID# A/D LAST,FIRST,TITLE††† ACKNOWLEDGE†††† CLASSIFICATION†††† SITE

----------------------------------------------------------------------------

7†† A†† BERENGER,THOMAS†††† TOM†††††††††††† COUNTY DATA ENTRYCNTY-19|HOSP*

IS THIS THE PERSON? <?> [Enter]

NAME (LAST,FIRST MIDDLE,TITLE) <BERENGER,THOMAS,COUNTY CLERK> [Enter]

CLASSIFICATION > <500> [Enter]

PASSWORD > <3769281114> [Enter]

ACKNOWLEDGEMENT NAME > <TOM> [Enter]

PHONE > <213-555-2321> [213-555-1200 X1736] [Enter]


AVSS Quick Reference Manual††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††† System Maintenance, ID File (continued)

 

 

ALL COUNTYS <N> [Enter]

CNTY. COUNTY > [19][Enter] = LOS ANGELES

ALL HOSPITALS <N> [Y][Enter]

DISPLAY HELP > [Enter]

DISPLAY LISTS > [Enter]

LAST,FIRST MIDDLE,TITLE >BERENGER,THOMAS,COUNTY CLERK

CLASSIFICATION > 500

PASSWORD > 3769281114

ACKNOWLEDGEMENT NAME > TOM

PHONE > 213-555-1200 X1736

INDEX > CNTY-19|HOSP*

DISPLAY HELP >

DISPLAY LISTS >

OK? (Y/N) > [Y] [Enter]

SETTING UP ID FILE ENTRY ...

ID FILE FUNCTION >

 

DEACTIVATE A USER

SYSTEM OPTION > [S][Enter]YSTEM MAINTENANCE OPTION

SYSTEM MAINTENANCE OPTION > [ID][Enter]FILE

ID FILE FUNCTION > [D][Enter]††††††††††† EACTIVATE

NAME (LAST,FIRST) > [LAM][Enter]

ID#A/D LAST,FIRST,TITLE††† ACKNOWLEDGE†† CLASSIFICATION†††††† SITE

-------------------------------------------------------------------------------

3††† A†† LAMOREAUX,BELINDA†† LINDA†††††††† HOSPITAL DATA ENTRYCNTY-19|HOSP-123

IS THIS THE PERSON? <Y> [Enter]

LAMOREAUX,BELINDA†††††† OK TO DEACTIVATE <N> [Y] [Enter] DEACTIVATED.

ID FILE FUNCTION >

 

REACTIVATE A USER

SYSTEM OPTION > [S][Enter]YSTEM MAINTENANCE OPTION

SYSTEM MAINTENANCE OPTION > [ID][Enter]FILE

ID FILE FUNCTION > [R][Enter]††††††††††† EACTIVATE

NAME (LAST,FIRST) > [WAL][Enter]

ID#A/D LAST,FIRST,TITLE†† †††ACKNOWLEDGE†††† CLASSIFICATION††††† SITE

--------------------------------------------------------------------------------

5††† A†† WALTERS,PEGGY,CLERK†† PEGGY†††††††††† HOSPITAL DATA ENTRY CNTY-19|HOSP-123

IS THIS THE PERSON? <Y> [Enter]

WALTERS,PEGGY,CLERK OK TO REACTIVATE <N> [Y] [Enter] REACTIVATED.

ID FILE FUNCTION >


AVSS Quick Reference Manual††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††† System Maintenance, ID File (continued)

 

 

LIST USERS

SYSTEM OPTION > [S] [Enter] YSTEM MAINTENANCE OPTION

SYSTEM MAINTENANCE OPTION > [ID] [Enter] FILE

ID FILE FUNCTION > [L][Enter] IST

 

LIST ACTIVE USERS ONLY <Y> [N] [Enter]

 

ID#A/D††† LAST,FIRST,TITLE††††††††††††††††††††††††††††† ACKNOWLEDGE†††††††††††† CLASSIFICATION†††††††††††††††††††††††† SITE

--------------------------------------------------------------------------------------------------------------------------------------------------------

7††††† A††††††† BERENGER,THOMAS,CLERK†††††††† TOM††††††††††††††††††††††††††††† COUNTY DATA ENTRY†††††††††††††† CNTY-19|HOSP-*

6††††† D††††††† DORFMAN,RENEE,MANAGER††††††† RENEE††††††††††††††††††††††† SITE SYSTEM MANAGER†††††††††† CNTY-*|HOSP=*

8††††† A††††††† FINCH,ROBIN,BIRTH CLERK††††††††† ROBIN†††††††††††††††††††††††† HOSPITAL DATA ENTRY††††††††††† CNTY-19|HOSP-123

2††††† A††††††† JONES,SANDRA,BIRTH CLERK†††† SANDY†††††††††††††††††††††††† HOSPITAL DATA ENTRY††††††††††† CNTY-19|HOSP-123

3††††† D††††††† LAMOREAUX,BELINDA†††††††††††††††††††† LINDA††††††††††††††††††††††††† HOSPITAL DATA ENTRY††††††††††† CNTY-19|HOSP-123

1††††† A††††††† SANDIEGO,CARMEN†††††††††††††††††††††††† CARMEN†††††††††††††††††††† SITE SYSTEM MANAGER†††††††††† CNTY-*|HOSP-*

4††††† A††††††† WILSON,DENNIS,SYS MGR†††††††††††† DENNIS†††††††††††††††††††††† SITE SYSTEM MANAGER†††††††††† CNTY-*|HOSP-*

5††††† A††††††† WALTERS,PEGGY,CLERK†††††††††††††† PEGGY††††††††††††††††††††††† HOSPITAL DATA ENTRY††††††††††† CNTY-19|HOSP-123

 

 

ID FILE FUNCTION >

 

 

LIST USERS' LAST LOGIN

SYSTEM OPTION > [S] [Enter] YSTEM MAINTENANCE OPTION

SYSTEM MAINTENANCE OPTION > [ID] [Enter] FILE

ID FILE FUNCTION > [U] [Enter]††††† SER LAST LOGIN LIST

 

DATE†††††††††††††† TIME††††††††††††††† NAME

-------------------------------------------------------------------------------------------------------------------------------------

04/11/06†††††††† 12:23 PM††††††† FINCH,ROBIN,BIRTH CLERK

04/11/06†††††††† 08:01 AM†††††††† WILSON,DENNIS,SYS MGR

04/10/06†††††††† 05:22 PM††††††† BERENGER,THOMAS,CLERK

04/10/06†††††††† 03:52 PM††††††† JONES,SANDRA,BIRTH CLERK

04/10/06†††††††† 01:36 PM††††††† SANDIEGO,CARMEN

04/08/06†††††††† 03:02 PM††††††† WALTERS,PEGGY,CLERK

02/14/06†††††††† 08:52 AM†††††††† LAMOREAUX,BELINDA

12/10/06†††††††† 09:10 AM†††††††† DORFMAN,RENEE,MANAGER

 

 

ID FILE FUNCTION >

 


CLASSIFICATION/SECURITY OPTION TABLES

 

Classification types:

††††† 100††††† SITE SYSTEM MANAGER

††††† 200††††† COUNTY SYSTEM MANAGER††††

††††† 300††††† HOSPITAL SYSTEM MANAGER

††††† 400††††† REMOTE HOSPITAL MANAGER

††††† 500††††† COUNTY DATA ENTRY

††††† 600††††† HOSPITAL DATA ENTRY††††††

††††† 700††††† REMOTE HOSPITAL DATA ENTRY

††††† 800††††† ANALYST

††††† 900††††† RESERVED FOR FUTURE USE

 

HOSPITAL BIRTH RECORD OPTION†††† ††† Classification

 

MENU OPTION:

100

200

300

400

500

600

700

800

900

REGISTER BIRTH RECORD

 

 

DISPLAY RECORD

 

 

EDIT RECORD

 

 

ALPHA LIST OF RECORD

 

 

COMPLETE INCOMPLETE RECORD

 

 

INCOMPLETE RECORD REPORT

 

 

FILING VARIABLE LIST

 

 

VARIABLE DISPLAY

 

 

INDEX LIST DISPLAY

 

 

NON-CONFIDENTIAL DISPLAY

 

VALIDATION DISPLAY

 

 

INDIVIDUAL INQUIRY

 

 

USER REPORT

 

 

 

 

 

USER REPORT BY ACTIVITY INDEX

 

 

 

 

 

USER SUMMARY

 

 

 

 

 

PRINT RECORD

 

 

 

SCRATCH RECORD

 

 

 

 

 

MODIFY USER LISTS

 

 

OLD LIST TO BE SENT TO HEALTH DEPT

 

 

 

PROCESS REGISTRAR REFUSED RECORDS

 

 

VERIFICATION LETTER

 

 

 

DUPLICATE RECORD REPORT BASED ON NAME

 

 

 

 

 

LIST TO BE SENT TO HEALTH DEPT

 

 

 

GENERATE HOSPITAL CBC FILE

 

 

 

 

 

HOSPITAL UNSENT LIST OF INCOMPLETES

 

 

NEWSPAPER ANNOUNCEMENT REPORT

 

 

 

HP LASERJET FORM ALIGNMENT

 

 

 

 

 

MAILBOX†††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††† ††† Classification

 

MENU OPTION:

100

200

300

400

500

600

700

800

900

SEND MAIL

PRINT MAIL

DELETE MAIL

REPORT STATUS OF SENT MAIL

 


CLASSIFICATION/SECURITY OPTION TABLES (continued)

 

Classification types:

††††† 100††††† SITE SYSTEM MANAGER

††††† 200††††† COUNTY SYSTEM MANAGER††††

††††† 300††††† HOSPITAL SYSTEM MANAGER

††††† 400††††† REMOTE HOSPITAL MANAGER

††††† 500††††† COUNTY DATA ENTRY

††††† 600††††† HOSPITAL DATA ENTRY††††††

††††† 700††††† REMOTE HOSPITAL DATA ENTRY

††††† 800††††† ANALYST

††††† 900††††† RESERVED FOR FUTURE USE

 

 

YOUR PASSWORD†††††††††††††††††††††††††††††††††††††††† ††† Classification

 

MENU OPTION:

100

200

300

400

500

600

700

800

900

CHANGE YOUR PASSWORD

 

 

 

REPORT GENERATOR OPTION††††††††††††† ††† Classification

 

MENU OPTION:

100

200

300

400

500

600

700

800

900

QUERY DATABASE

 

GENERATE REPORT

 

OUTPUT SAVED REPORT

 

LIST SAVED REPORTS

 

DELETE SAVED REPORT

 

 

 

 

 

 


GLOSSARY OF TERMS

 

Terms††††††††††††††††††††††††††††††††††††† Meaning

 

backing out†††††††††††††††† A way to exit from AVSS .

 

backup†††††††††††††††††††††††† The process creating duplicate files or copies in case the original is lost or damaged.

 

bug†††††††††††††††††††††††††††††† An error in a program.

 

concatenate††††††††††††††† To string or link together values.In AVSSthese values should be separated by semi-colons.

 

control key†††††††††††††††††† The key usually marked CTRL.

 

CRT terminal††††††††††††† Cathode Ray Tube terminal or the video display.

 

cursor††††††††††††††††††††††††† The cursor (usually an underline or block) which shows you where you are on the screen.

 

data/data field(s)†††††† The information entered into your computer.Refers to either a single piece of information or a

††††††††††††††††††††††††††††††††††††† collection of information.

 

database†††††††††††††††††††† A collection of many files related to a particular topic (e.g. birth records).

 

default††††††††††††††††††††††††††††††† A field which appears to be pre-entered and does not require you to enter any data.

††††††††††††††††††††††††††††††††††††† (e.g. field 3A of Birth Certificate always contains the value 'SINGLE').

 

device††††††††††††††††††††††††† Refers to a piece of hardware such as a terminal, printer, or modem.

 

disk††††††††††††††††††††††††††††† A device for storing data which are commonly classified as hard disks and floppy disks (also known

††††††††††††††††††††††††††††††††††††† as diskettes).

 

disk crash†††††††††††††††††††††††† The failure of your computer's hard drive.This failure usually occurs suddenly and can result

††††††††††††††††††††††††††††††††††††† in the loss of your data.

 

disk drive†††††††††††††††††††† A device that can be used to "read" and "write" on a hard disk or diskette.

 

diskette††††††††††††††††††††††† Sometimes called "floppy disk" in contrast to "hard disk".A diskette is a piece of flexible plastic.

††††††††††††††††††††††††††††††††††††† Common sizes include 5 1/4 inch and 3 1/2 inch diameter.

 

edit†††††††††††††††††††††††††††††† To change the data which has been entered into your computer.

 

error†††††††††††††††††††††††††††† A problem occurring during the use of AVSS which may prevent you from proceeding.

††††††††††††††††††††††††††††††††††††† You should note the error, then contact your AVSS programmer.

 

field††††††††††††††††††††††††††††† A reserved area in a record used for storage of specific information.

 

file†††††††††††††††††††††††††††††††† A collection of records containing similar information.

 

file number†††††††††††††††† The number used to identify and file this record into AVSS.

 

floppy disk†††††††††††††††††††††††† An informal name for a diskette.

 

hard disk†††††††††††††††††††† A disk which is rigid and cannot be removed, in contrat to a "floppy disk".

 

hardware†††††††††††††††††††† The physical components of a computer system (e.g. "the computer", plus peripheral devices

††††††††††††††††††††††††††††††††††††† such as disk drives, CRT terminals, printers, tape drives, and modems.

 

help††††††††††††††††††††††††††††† Information giving instructions on how to proceed or the kind of data required for a field.

 

incomplete record†††† A record which has not been completed.

 

input†††††††††††††††††††††††††††† The process of entering data into the computer or the collection of data which has been entered.

 

input device††††††††††††††† A device which can be used to "read" data into a computer.Typical examples include CRT terminals

††††††††††††††††††††††††††††††††††††† or disk drives, including hard and floppy disks.


GLOSSARY OF TERMS (contined)

 

Terms††††††††††††††††††††††††††††††††††††† Meaning

 

job††††††††††††††††††††††††††††††† Any system activity.Each time you log-on to AVSS , you are running a job.

 

logoff††††††††††††††††††††††††††† The process of exiting or leaving the AVSScomputer system.

 

logon††††††††††††††††††††††††††† The process of gaining access to AVSS .

 

menu†††††††††††††††††††††††††† The list which displays for you the different options available for use on the AVSS system.

 

modem††††††††††††††††††††††† The device which is used by your computer to transmit data between computers.

 

null†††††††††††††††††††††††††††††† A blank data value.

 

optional†††††††††††††††††††††† Data which is not required by AVSS to complete a record.

 

output†††††††††††††††††††††††††† The results of a job (e.g. printing a certificate, printing a report).

 

output device††††††††††††† A device which output is displayed or stored such as a printer or CRT terminal

 

password††††††††††††††††††† A string of 3 to 48 characters, either alphabetic or numeric, that allows you to log onto AVSS.

 

peripheral device†††††† Any hardware device other than the computer itself.

 

program††††††††††††††††††††† A list of instructions for computer operations, written in a programming language.

 

prompt†††††††††††††††††††††††† A message that is displayed AVSS which request some action from the user.

 

question mark††††††††††† Used to display the 'HELP' information on AVSS.Use '?' or [F1] at any prompt for extra information

††††††††††††††††††††††††††††††††††††† about the data you should enter.

 

record††††††††††††††††††††††††† A group of related data fields usually referring to all the information on one baby's file.

 

required†††††††††††††††††††††† Information that MUST be entered for a field.Use [F9] (SKIP) if you don't have the information

††††††††††††††††††††††††††††††††††††† available to you and you want to continue entered data.

 

routine†††††††††††††††††††††††† See program.

 

sign-on††††††††††††††††††††††† To start a session with AVSS.See logon.

 

sign-off††††††††††††††††††††††† To stop a session with AVSS.See logoff.

 

software††††††††††††††††††††† The programs that control computer operations.

 

system†††††††††††††††††††††††† A combination of hardware and software designed to perform specific functions.

 

terminal†††††††††††††††††††††† The screen and keyboard you use to enter data into AVSS.See CRT Terminal.

 

time-out†††††††††††††††††††††† AVSS will log you off after a certain amount of time if you haven't entered any data.

 

up-arrow††††††††††††††††††††† The circumflex or '^ ' key on your keyboard. (Hold the shift key down, press the '6' key)

 

validation †††††††††††† The process of checking the data you've just entered for accuracy and consistency.

 

variable††††††††††††††††††††††† The letter or group of letters which represents a changing value (e.g. "1A" is the variable name

††††††††††††††††††††††††††††††††††††† for the first name of the baby, "BPF" is the variable name for the Baby's Patient File number).

††††††††††††††††††††††††††††††††††††† These variable names or field names exactly match the numbers on a Certificate of Live Birth.

 


†††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††† ERRORS/WARNINGS

 

ACCESS TO THIS CERTIFICATE IS RESTRICTED

See HOSPITAL BIRTH RECORD,

††††† PROCESS REGISTRAR REFUSED

††††† RECORDS

 

 

HORIZONTAL ADJUSTMENT OUT OF RANGE

See HOSPITAL BIRTH RECORD,

††††† HP LASERJET FORM ALIGNMENT

 

 

LASERJET PRINTER NOT SPECIFIED

See HOSPITAL BIRTH RECORD,

††††† HP LASERJET FORM ALIGNMENT

 

 

VERTICAL ADJUSTMENT OUT OF RANGE.

See HOSPITAL BIRTH RECORD,

††††† HP LASERJET FORM ALIGNMENT

 

 

WARNING:SOURCE FORM HAS SKIPPED FIELDS,

CONTINUE <Y>

See HOSPITAL BIRTH RECORD,

††††† COMPLETE INCOMPLETE RECORD

 

 

WARNING:SOURCE FORM SELECTED HAS BEEN ^FILED,

CONTINUE <Y>

See HOSPITAL BIRTH RECORD,

††††† COMPLETE INCOMPLETE RECORD

 

 

YOUR PASSWORD HAS EXPIRED.CHANGE YOUR PASSWORD!

See YOUR PASSWORD,

††††† CHANGE YOUR PASSWORD

 

 

YOUR PASSWORD WILL EXPIRE IN x DAYS

See YOUR PASSWORD,

††††† CHANGE YOUR PASSWORD

 

 


AVSS CROSS-REFERENCES, VALIDATIONS, AND WARNINGS FROM CBC SPECS

 

VALIDATIONS

 

AVSS requires the user to confirm data values that do not satisfy validations.Records cannot be printed or filed unless

inconsistencies are validated or tbe ^SKIP command is used for the questionable data, which will result in an incomplete

record.

 

FIELD(S)††††††††††††††††††††† †††††††††††††††††††††††† DESCRIPTION††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††††

(lC)<2characters†††††††††††††††††††††††††††††††† Child's last name has less than 2 characters.

(2) not= 1 or 2††††††††††††††††††††††††††††††††††††† Sex is undetermined.

(3A)>3†††††††††††††††††††††††††††††††††††††††††††† Plurality is greater than 3.

(3B)=1&((4A